KEGG   Caenorhabditis elegans (nematode): CELE_W02A2.7Help
Entry
CELE_W02A2.7      CDS       T00019                                 

Gene name
mex-5
Definition
(RefSeq) Zinc finger protein mex-5
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-CCCH zf-CCCH_4 Torus zf-CCCH_2
Motif
Other DBs
NCBI-GeneID: 178296
NCBI-ProteinID: NP_502566
WormBase: WBGene00003230
Ensembl: WBGene00003230
UniProt: Q9XUB2
Position
IV:join(13353730..13353843,13353892..13354412,13354458..13354881,13354932..13355080,13355345..13355543)
Genome map
AA seq 468 aa AA seqDB search
MKAASNSVSSAGGSVSPTTTQPPLPPGQSSHPQIYDQQMQYYFAAAMPNQPMATYAAQNG
SSQQYAPAAPYYQDANGQYVQVPANGSMAPQQHMMVSGQPYLYMAQPQQGAQQVMQSGQP
QLIYYQQSMAPQAAPMYFHPMQAAPMLPEQMGVMPHTQPAIPPQQQPRQVGVEISSTRTA
PLTSSTPLPTSLEYETVQRDNRNRNIQFRYHRVMEHDELPIDEISKITLDNHNDDTMSAE
KENHFHEHRGEKFGRRGFPIPETDSQQPPNYKTRLCMMHASGIKPCDMGARCKFAHGLKE
LRATDAPARYPNNKYKTKLCKNFARGGTGFCPYGLRCEFVHPTDKEFQNIPPYQRMSHDD
QDYDQDVIPEDYVVARHQPRFMRTGGRATTPTKVMLKHRNVAGSMMCLSNAGRDLQAGGD
YNQPESNEDDLPPHLRRNRRENPPMNKRRTSLSTKWTSEENLGLRGHY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcatcaaatagtgtctcgtcggccggaggatcagtgtcacctacgacaacc
cagccaccactaccaccagggcagtcgtcacatcctcaaatctacgatcaacagatgcag
tactacttcgcggctgccatgccgaaccagccaatggcgacgtatgcggcacaaaatgga
tcttctcaacagtacgccccagcggctccatattatcaagatgccaacggacagtatgtg
caggttcccgcgaacggatcaatggctcctcaacagcacatgatggtttctggtcaaccg
tatctctatatggctcaaccacaacaaggagctcagcaagtcatgcagtcaggacaacca
cagctcatctattatcaacaatcaatggctccacaagcggctccaatgtacttccatcct
atgcaagccgcaccgatgcttccagaacaaatgggtgtgatgccacatacgcagccggca
attccacctcaacaacagccaagacaagtgggagtggagattagtagcacacgcacagct
ccattgacctcgtctactcctcttccaacaagtctcgaatacgagactgttcagcgtgat
aatcgcaacaggaacatccaattcagatatcatcgtgttatggagcatgacgagttgccg
atcgatgagatctcaaagatcacccttgacaatcacaacgatgacacgatgagcgctgaa
aaggaaaatcatttccatgaacatcgtggcgagaagttcggtcgtcgtggattcccaatt
ccagaaactgacagtcaacaaccacccaactacaagactcgtctttgcatgatgcacgca
tctggaatcaaaccatgtgatatgggtgctcgatgcaagtttgctcatgggctcaaagag
ctcagagctactgatgctccggctcgctatccgaacaacaagtacaagacaaagctgtgc
aagaactttgcgcgtggaggaactggattctgcccgtatggacttcgttgcgagtttgtt
catccaacggacaaggaattccagaatattcctccatatcagcgcatgtctcacgatgac
caggattacgaccaggatgtcattccagaagactacgttgtcgctagacatcagccacga
ttcatgcgtacaggtggaagagctaccacgccgaccaaagtgatgctcaaacatcgaaat
gtggcaggctcaatgatgtgcctctccaatgctggtcgcgatcttcaagccggaggtgat
tacaatcaaccggaatccaacgaagacgacttgccaccacacttgagacggaatcgcaga
gaaaatccaccgatgaacaagcgtcgcacatctctcagcacgaagtggacatctgaggaa
aatctcggactaagaggacactattag

DBGET integrated database retrieval system