KEGG   Caenorhabditis elegans (nematode): CELE_W02D3.9
Entry
CELE_W02D3.9      CDS       T00019                                 

Gene name
unc-37
Definition
(RefSeq) Transcription factor unc-37
  KO
K04497  groucho
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04310  Wnt signaling pathway
cel04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_W02D3.9 (unc-37)
   04330 Notch signaling pathway
    CELE_W02D3.9 (unc-37)
SSDB
Motif
Pfam: WD40 TLE_N ANAPC4_WD40 zf-C4H2
Other DBs
NCBI-GeneID: 172394
NCBI-ProteinID: NP_491932
WormBase: WBGene00006773
Ensembl: WBGene00006773
UniProt: O02482
Position
I:complement(join(6742524..6742682,6743201..6743948,6744002..6744197,6744285..6744795,6745048..6745191,6745244..6745324))
AA seq 612 aa
MKASYLETLDRIKDEHAEMSKHVNQQRSDIEKVALEKENMNRSYMTYAEVSNTLRSDLRK
AEEINKRLQEFIMQSLAPQLSQDNQANCLAALEAFKTASPRENGNGAPALPPGFPPGAAG
MLGMMPNMPFGMSPAMSQLFNQFASPHVNGGDGAGGSSGGASEAKKAKLEDPDDGELEID
VTNDDHPSTASNGGAANKNGRDSTNSVASSGASTPSIASNSRARQQQQPLAGLQGLEQMN
FLAGFNPNLLRQASAAGGFNFLNDPHAQARLAAAIGQIGSRPAYSFKIVDGGVPTPTSFP
PDAQKGPGIPTGLKKKMELNHGEVVCAATISRDNSRVYTGGKGCVKIWDVKESDISGATV
VNRPPIASLDCLKENYIRSCKLFEDGNTLLIGGEASTVALWDLTTETKTLDLETDSQACY
ALAMSPDEKLLFACLADGNILIYDIHNKVKVGTLPGHQDGASCLDLSKDGTKLWSGGLDN
SVRCWDLAQRKEVAKHDFASQVFSLGCCPNDEWVAVGMENNYVEVLSTTGKEKYQLTQHE
SCVLSLKFAHSGKFFISTGKDNALNAWRTPYGASLFQLKENSSVLSCDISFDDSLIVTGS
GEKKATLYAVEY
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgaaggcatcgtatctggaaaccctcgatcgaatcaaagacgagcatgcggaaatgtcg
aagcatgtcaaccagcaacgatcggatatcgaaaaggttgcgttagagaaagaaaatatg
aatagatcgtatatgacgtacgctgaagtatcaaatactcttcgtagcgatcttcgaaaa
gcagaagaaatcaacaaacgccttcaggaattcatcatgcaatcgttggctcctcaacta
tctcaagataatcaagcaaactgcctcgccgcactggaagctttcaaaaccgcatcacca
cgtgaaaatggaaatggagcaccagcacttccaccaggttttcctcccggtgcagctgga
atgcttggaatgatgccaaatatgccattcggaatgagccctgcaatgagtcaactattc
aatcaattcgcatcaccacatgtcaacggtggagatggagccggtggaagttctggaggt
gcaagtgaagcgaaaaaggccaagctggaagatccagatgatggagaacttgagattgat
gtcacaaatgatgatcatccaagtactgcatcaaatggaggcgcagctaataaaaatgga
agagatagcacaaatagtgttgcctcatcgggagcatctacaccgagcatcgcatcaaat
tctagagcaagacaacaacagcagccactcgctgggcttcaaggattggagcaaatgaac
tttttagctggattcaatccaaatcttctccgacaagctagtgctgctggaggattcaac
tttttgaatgatccccatgcacaggcccgtcttgcagctgccatcgggcaaatcggtagc
agaccggcctattcattcaaaattgtggacggtggagttccaacacctacatccttccct
ccagatgcacagaaaggtcccggaattccgacaggtctcaagaagaaaatggaattaaat
cacggagaagtagtttgtgcggccacaatttcccgtgataacagtcgtgtttatactggt
ggaaaaggatgtgttaagatctgggatgtcaaagaatcagatatttctggcgcaacggtt
gtgaatcggcctccaattgcatccttggattgtctcaaagagaactatattagatcttgt
aaactctttgaagatggaaatacacttctgattggaggagaagccagtactgttgctctt
tgggatcttacaactgaaacaaaaactttggacttggaaactgattcacaagcatgctac
gcgttggcgatgtcaccagatgagaaattattgttcgcatgtcttgctgatggaaatatc
ctcatttatgatatccataataaggtgaaagttggaaccctacctggacatcaagatgga
gcatcatgtctcgatctctcaaaagatggtacaaagctctggtcaggtggtcttgacaat
tctgttagatgctgggatcttgcacaacgaaaggaagttgcgaagcatgattttgcgagc
caagttttctctcttggatgttgtccaaatgatgaatgggtggctgttggtatggagaat
aattatgtcgaggttctgtcaacaactggaaaagaaaagtatcaattgacacaacacgaa
tcatgcgtcctttcgctcaaatttgcgcattccggaaagttcttcatttcaactggaaag
gacaatgctctcaacgcctggcgtactccatacggagcatcactctttcaactaaaagag
aacagctccgttctctcatgtgacatctcattcgacgactcactcattgtcactggatca
ggggagaagaaggcaactctctatgcagttgaatattaa

DBGET integrated database retrieval system