KEGG   Caenorhabditis elegans (nematode): CELE_W02D3.9Help
Entry
CELE_W02D3.9      CDS       T00019                                 

Gene name
unc-37
Definition
(RefSeq) Transcription factor unc-37
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 TLE_N ANAPC4_WD40 zf-C4H2 GAS
Motif
Other DBs
NCBI-GeneID: 172394
NCBI-ProteinID: NP_491932
WormBase: WBGene00006773
Ensembl: WBGene00006773
UniProt: O02482
Position
I:complement(join(6742524..6742682,6743201..6743948,6744002..6744197,6744285..6744795,6745048..6745191,6745244..6745324))
Genome map
AA seq 612 aa AA seqDB search
MKASYLETLDRIKDEHAEMSKHVNQQRSDIEKVALEKENMNRSYMTYAEVSNTLRSDLRK
AEEINKRLQEFIMQSLAPQLSQDNQANCLAALEAFKTASPRENGNGAPALPPGFPPGAAG
MLGMMPNMPFGMSPAMSQLFNQFASPHVNGGDGAGGSSGGASEAKKAKLEDPDDGELEID
VTNDDHPSTASNGGAANKNGRDSTNSVASSGASTPSIASNSRARQQQQPLAGLQGLEQMN
FLAGFNPNLLRQASAAGGFNFLNDPHAQARLAAAIGQIGSRPAYSFKIVDGGVPTPTSFP
PDAQKGPGIPTGLKKKMELNHGEVVCAATISRDNSRVYTGGKGCVKIWDVKESDISGATV
VNRPPIASLDCLKENYIRSCKLFEDGNTLLIGGEASTVALWDLTTETKTLDLETDSQACY
ALAMSPDEKLLFACLADGNILIYDIHNKVKVGTLPGHQDGASCLDLSKDGTKLWSGGLDN
SVRCWDLAQRKEVAKHDFASQVFSLGCCPNDEWVAVGMENNYVEVLSTTGKEKYQLTQHE
SCVLSLKFAHSGKFFISTGKDNALNAWRTPYGASLFQLKENSSVLSCDISFDDSLIVTGS
GEKKATLYAVEY
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcatcgtatctggaaaccctcgatcgaatcaaagacgagcatgcggaaatgtcg
aagcatgtcaaccagcaacgatcggatatcgaaaaggttgcgttagagaaagaaaatatg
aatagatcgtatatgacgtacgctgaagtatcaaatactcttcgtagcgatcttcgaaaa
gcagaagaaatcaacaaacgccttcaggaattcatcatgcaatcgttggctcctcaacta
tctcaagataatcaagcaaactgcctcgccgcactggaagctttcaaaaccgcatcacca
cgtgaaaatggaaatggagcaccagcacttccaccaggttttcctcccggtgcagctgga
atgcttggaatgatgccaaatatgccattcggaatgagccctgcaatgagtcaactattc
aatcaattcgcatcaccacatgtcaacggtggagatggagccggtggaagttctggaggt
gcaagtgaagcgaaaaaggccaagctggaagatccagatgatggagaacttgagattgat
gtcacaaatgatgatcatccaagtactgcatcaaatggaggcgcagctaataaaaatgga
agagatagcacaaatagtgttgcctcatcgggagcatctacaccgagcatcgcatcaaat
tctagagcaagacaacaacagcagccactcgctgggcttcaaggattggagcaaatgaac
tttttagctggattcaatccaaatcttctccgacaagctagtgctgctggaggattcaac
tttttgaatgatccccatgcacaggcccgtcttgcagctgccatcgggcaaatcggtagc
agaccggcctattcattcaaaattgtggacggtggagttccaacacctacatccttccct
ccagatgcacagaaaggtcccggaattccgacaggtctcaagaagaaaatggaattaaat
cacggagaagtagtttgtgcggccacaatttcccgtgataacagtcgtgtttatactggt
ggaaaaggatgtgttaagatctgggatgtcaaagaatcagatatttctggcgcaacggtt
gtgaatcggcctccaattgcatccttggattgtctcaaagagaactatattagatcttgt
aaactctttgaagatggaaatacacttctgattggaggagaagccagtactgttgctctt
tgggatcttacaactgaaacaaaaactttggacttggaaactgattcacaagcatgctac
gcgttggcgatgtcaccagatgagaaattattgttcgcatgtcttgctgatggaaatatc
ctcatttatgatatccataataaggtgaaagttggaaccctacctggacatcaagatgga
gcatcatgtctcgatctctcaaaagatggtacaaagctctggtcaggtggtcttgacaat
tctgttagatgctgggatcttgcacaacgaaaggaagttgcgaagcatgattttgcgagc
caagttttctctcttggatgttgtccaaatgatgaatgggtggctgttggtatggagaat
aattatgtcgaggttctgtcaacaactggaaaagaaaagtatcaattgacacaacacgaa
tcatgcgtcctttcgctcaaatttgcgcattccggaaagttcttcatttcaactggaaag
gacaatgctctcaacgcctggcgtactccatacggagcatcactctttcaactaaaagag
aacagctccgttctctcatgtgacatctcattcgacgactcactcattgtcactggatca
ggggagaagaaggcaactctctatgcagttgaatattaa

DBGET integrated database retrieval system