KEGG   Caenorhabditis elegans (nematode): CELE_W02D9.5Help
Entry
CELE_W02D9.5      CDS       T00019                                 

Gene name
ssp-37
Definition
(RefSeq) Sperm Specific family, class P
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Motile_Sperm
Motif
Other DBs
NCBI-GeneID: 173127
NCBI-ProteinID: NP_493185
WormBase: WBGene00012211
Ensembl: WBGene00012211
UniProt: Q9XVH1
Position
I:complement(join(12561140..12561333,12561404..12561548))
Genome map
AA seq 112 aa AA seqDB search
MNLLLIFFAAMVSGSFGAFFRKTLSLTADPPTCTVPATGGFSAHKLVNEFGFVDPFGSKD
IVITRTAGAPNWNDKLVIHYAPAPADATDAQAAFAAATLTGQALTIPLTATA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcttcttatcttctttgctgctatggtttccggttcctttggcgcattcttc
cgcaagaccctgtccctgactgccgatccaccaacttgtaccgtcccagccactggagga
ttttcggcccacaagctcgtcaatgagttcggatttgtcgatccattcggatcaaaggat
attgtgatcacccgcactgctggtgcaccaaattggaatgataagcttgtcattcattat
gcaccagctccagctgatgctactgatgctcaagccgcttttgctgcagccactcttact
ggtcaggcactcaccattccattgacggccaccgcctaa

DBGET integrated database retrieval system