KEGG   Caenorhabditis elegans (nematode): CELE_W03B1.4
Entry
CELE_W03B1.4      CDS       T00019                                 

Gene name
sars-2
Definition
(RefSeq) AA_TRNA_LIGASE_II domain-containing protein
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_W03B1.4 (sars-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_W03B1.4 (sars-2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_W03B1.4 (sars-2)
Enzymes [BR:cel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     CELE_W03B1.4 (sars-2)
Amino acid related enzymes [BR:cel01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CELE_W03B1.4 (sars-2)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CELE_W03B1.4 (sars-2)
 Prokaryotic type
    CELE_W03B1.4 (sars-2)
SSDB
Motif
Pfam: tRNA-synt_2b tRNA-synt_2d
Other DBs
NCBI-GeneID: 177200
NCBI-ProteinID: NP_500549
WormBase: WBGene00005662
Ensembl: WBGene00005662
UniProt: G5EF77
Position
IV:join(4357641..4357831,4357906..4358213,4358664..4359141,4359475..4359724,4359777..4359875)
AA seq 441 aa
MQRLSQALRSTRISQGIGFARRFTSSEASTSEESSSAPPVMRPDLNFEFLLDEKNLEAIR
ENILNRKGVGDIDKVHKKWAVIQKMMKSGEKQTNGAVSEQKYKQLWDELYDEAILIPNMT
QDGVPRGSEDQAKIVAEWGEKREDECLTAEKLVQTWRSLLHPTDASGQRSYVFLGALASL
EKALLDYAHERVCALGFRPITVPDIVSGEVTQACGVMQRSDHPIQYTLAGEESHTKLSGT
AEMGIAAFLRGRTFNQDQLPIRLVSLSRCFRTEISKSASEAKLYRVHEFSKVEMFVVSTP
EQSAAELDYLVEVQKGTFQALGVHCRQLEMPSEELGASAARKFDIEAWMPGRKLYGEVSS
ASNCTDFQSRRLGIKYKTADGTTKYAHTCNGTALASTRALISVLETFQNDKKGLGELPEP
LRKRVKQRGSPLRFQPAKSLV
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgcaaagattaagccaagctcttcggagcactagaataagtcaaggaatcgggtttgcc
agaagattcacgtcatcagaagcttcaacatcagaagaaagctcatctgcaccgcctgtc
atgaggccagacttgaatttcgaatttttactggatgagaagaatttagaagcaattcga
gagaacattttaaatcgaaaaggagttggcgatattgacaaagtgcacaaaaaatgggcc
gtaattcaaaaaatgatgaaatccggtgaaaagcagacaaatggagctgtctccgagcaa
aaatataagcagctgtgggatgagctctacgatgaggcgattcttataccgaatatgaca
caggacggtgtgccacgtggcagtgaagatcaggcgaaaattgtggccgaatggggtgaa
aaacgagaagatgaatgtttgacagcggagaaattggtccaaacctggagatcactgctt
catccaactgatgcttcaggtcaacgctcttacgtattcctcggagccctggcaagtctg
gaaaaagcccttctggattatgctcacgaaagagtatgtgctctaggctttcgtccaatt
acagtacccgatatagtgtctggagaggtgacacaagcctgtggagttatgcaacgaagt
gatcatccaattcaatacaccttagctggagaagaatcacacacaaaactctcaggaact
gctgaaatgggaatcgccgcgtttttacggggacgaactttcaaccaagatcaacttccg
attcgattggtctcactgagtcgatgcttccgaactgagatcagcaagtcggcgagcgag
gcgaagttgtacagagttcatgagttcagcaaggttgagatgttcgtggtgagcacgccg
gagcaaagtgcggcagagctggattatttggtggaggtgcagaagggaacattccaggcg
ttgggtgttcattgcagacaacttgaaatgccatccgaagagcttggagcctctgccgcc
cggaaattcgacattgaagcttggatgccggggcgaaaactctacggagaggtttcatcg
gccagtaattgcacggatttccagtctcgacgcctcggaatcaagtataaaactgctgat
ggaacgacgaaatacgctcatacgtgtaatggaaccgctcttgcgtcgactagagctctc
atttctgtgctggaaacttttcagaatgacaaaaaaggactcggcgagcttccagaacct
cttcgaaaacgtgtcaagcaacgtggaagcccacttcgtttccaaccagcgaaatcactt
gtttag

DBGET integrated database retrieval system