KEGG   Caenorhabditis elegans (nematode): CELE_W05H5.4Help
Entry
CELE_W05H5.4      CDS       T00019                                 

Gene name
srh-27
Definition
(RefSeq) Serpentine Receptor, class H
  KO
K08473  nematode chemoreceptor
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cel04030]
    CELE_W05H5.4 (srh-27)
G protein-coupled receptors [BR:cel04030]
 Others
  Chemoreception
   Nematode chemoreception
    CELE_W05H5.4 (srh-27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TM_GPCR_Srh 7TM_GPCR_Sri 7TM_GPCR_Srd H_PPase
Motif
Other DBs
NCBI-GeneID: 189224
NCBI-ProteinID: NP_496647
WormBase: WBGene00005250
Ensembl: WBGene00005250
UniProt: P91841
Position
II:join(12448541..12448743,12448787..12449129,12449186..12449419,12449543..12449735,12449784..12449887)
Genome map
AA seq 358 aa AA seqDB search
MTPFLPDNESYYAFYEEQAKLNSHYKLSCHIIPFVTLPVYAEAFYCVFYKCKHFSKKYVV
LLQIHLFLHFFGELYWTILLIPVIVIPSIGVSADGFLSVLKISPSWQIIIMCGILQISTA
TMIHLLIFRLKFAIPPNAKYRSVIKYSVDFLNIFCYCTTIFCTCALGLLDEDQLTAKNRV
YEKFPIPNPNLWDENYVTTDIESYKFKTYVIISVLEIFILCVHIIVIPIVGFHFLSKNQT
EKSEKLAEAHRKTMQMLVFQLTVHCIFHLVPFVCFTWATIFKQGNIGLLSGGMFTWALHG
AACTLTLLLANKPFRMTTLSHLKYVFCCGCCNGSTAGISKMFRHRRESTVVQMIDFST
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgactccttttctacctgataacgagagctattacgctttttatgaggaacaggcaaag
ctcaacagtcactataaactgtcatgtcatattattccatttgtaacgttgccagtgtat
gctgaagccttctattgtgtattttataaatgcaaacattttagcaagaaatatgtggtt
ttactacaaattcatctgtttttacatttctttggtgagctctactggacaatcttgctc
attccagtaattgtcattcctagcatcggcgtctctgccgacggatttctcagcgttctc
aagatttctccaagttggcaaattatcataatgtgtggaatcctacaaatcagcactgcg
actatgattcatttgctaatttttcgattgaaatttgcgattccaccgaatgcgaaatat
cggagtgttatcaagtactccgtcgactttttgaatatattttgctactgtactacaatt
ttttgtacatgtgcattgggcttacttgatgaagatcagttaaccgcaaaaaatcgggtt
tacgagaaattccctataccaaatccgaacctttgggatgaaaattatgtaaccactgac
attgagagctacaaattcaaaacatatgttattatatcggtgttggaaatttttatactg
tgtgtacatattattgtgataccaattgttggattccattttctatcaaagaatcagaca
gagaaatcggagaagttggcagaagctcacaggaagactatgcagatgttggtttttcag
ctaaccgttcactgcatattccatcttgtgccatttgtctgtttcacttgggcaaccatt
tttaaacaaggaaatattggccttctgtcaggtggaatgttcacgtgggctctgcacgga
gccgcgtgcaccttgacgcttctcttggcaaataagccatttcgaatgacaacgttgagc
catttgaaatatgttttttgctgtggatgctgcaatggatcgacagctggaatctcgaaa
atgttccgtcatagaagagagtcgactgttgtgcaaatgattgatttttcaacttga

DBGET integrated database retrieval system