KEGG   Caenorhabditis elegans (nematode): CELE_W06B3.1
Entry
CELE_W06B3.1      CDS       T00019                                 
Symbol
nmat-1
Name
(RefSeq) Nicotinamide-nucleotide adenylyltransferase
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00760  Nicotinate and nicotinamide metabolism
cel01100  Metabolic pathways
cel01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CELE_W06B3.1 (nmat-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     CELE_W06B3.1 (nmat-1)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     CELE_W06B3.1 (nmat-1)
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-GeneID: 189236
NCBI-ProteinID: NP_001379025
WormBase: WBGene00012295
Ensembl: WBGene00012295
Position
X:complement(12014254..12018043)
AA seq 220 aa
MGTEKVVILAVGSFNPPTNGHLCMMEDAKYSLEKSGKIVLEGIMSPVSDGYAKKSLISAK
HRLAQTEAATYDSDWIHASGWECAQSEWTATVNVLKHHQQDVKNKLGSDVNVLLLFGGDV
IESFDKFYADGTPVWDREDVEEIISAGIVVRSRPGSDPEQTLKKLNLNENSDKVHFIKNA
ISSNSISSTSLRAALKEHRSIKYTTPDSVIKYIKDHRLYE
NT seq 663 nt   +upstreamnt  +downstreamnt
atggggaccgaaaaagttgtcattttggcagtcgggtcattcaatcctccaacaaatgga
catctttgcatgatggaggatgccaagtactcactagaaaagtcaggaaaaatagttctc
gaaggaattatgagcccagtcagtgatggttatgcgaaaaagagtttgatcagcgctaaa
catcgtcttgcacaaaccgaagcagcaacttatgattctgactggattcatgcaagtggt
tgggaatgtgcccagtctgagtggactgcaactgttaatgttctgaaacatcatcagcag
gatgtgaagaataaactcggaagtgatgtgaatgtgctcttgttgtttggaggtgacgtc
atcgaatcattcgacaagttttatgcagatggaacgccagtttgggatcgtgaagatgtt
gaggaaatcatctctgcaggaatagtcgtccgatcgcgacctggttcagatcctgaacaa
acccttaaaaaattgaacctcaatgaaaactctgacaaagtgcatttcatcaagaatgca
atctcgtcaaactcaataagttcaacaagtcttcgtgcagctctgaaagaacatcgctct
atcaaatacaccacaccagattccgtaatcaagtacattaaagatcatagactctacgaa
tga

DBGET integrated database retrieval system