KEGG   Caenorhabditis elegans (nematode): CELE_W06B4.2
Entry
CELE_W06B4.2      CDS       T00019                                 

Symbol
W06B4.2
Name
(RefSeq) BcrAD_BadFG domain-containing protein
  KO
K00884  N-acetylglucosamine kinase [EC:2.7.1.59]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00520  Amino sugar and nucleotide sugar metabolism
cel01100  Metabolic pathways
cel01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_W06B4.2 (W06B4.2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.59  N-acetylglucosamine kinase
     CELE_W06B4.2 (W06B4.2)
SSDB
Motif
Pfam: Methyltransf_16 BcrAD_BadFG PrmA MTS FGGY_C
Other DBs
NCBI-GeneID: 173784
NCBI-ProteinID: NP_494789
WormBase: WBGene00021057
Ensembl: WBGene00021057
UniProt: Q23195
Position
II:join(4468170..4468373,4468421..4468483,4469084..4469274,4469452..4469562,4469907..4470669,4470715..4470948)
AA seq 521 aa
MSGSAQNHWKHAWPCAQVFSDFLCSNQELIEDKLVLEIGAGATGVCGLTTAKLGAANVWM
TDHPKLEAALETLQRNIEANGVAEKCIVTGLDWESRASVSAVCDQIGDRHLDVIIASDVF
FDPSTFCPLIDTFAQLLIKFEHATIWFAYQLRDDNWTCAPYLSKYPFLRATLERRIETEK
ETIDIFKMTRESLGLYAGIEGGATGSKLVIIDADTNQRYTSSTEGTNFFLTDHTIVCKRI
ADWILEVFEKEKLDIKNLKALGLGLSGAEDEEFNKKFVDYFRQNHGNVTENFYLTSDAVM
TLLANFPGEENGIVLIAGTGSSCRLKIRDGSVKGAGGWGHQIGDGGSAFWIARTAIQMLF
DAEDGFEENFNTDVIKQLLFKHYNITDKTRMLDYLYSKFEKHKIADFTVSLAERTDDAAV
AEAFRRAGDVLGKHVRTVAKYLTNEDRKVLSIVQIGGVFQSWDALQQGFVASLSGSGIEK
IVMYEPSDSPAVGAAVLAAKERNEIFLQQNVEKKMLREINL
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgagtggttcagctcaaaatcactggaaacacgcctggccttgtgctcaagttttcagc
gattttctgtgcagtaaccaggaactaatcgaagacaagcttgttctcgaaattggagcc
ggagccaccggtgtctgtgggctcaccactgcgaagctgggagcagcgaacgtttggatg
acggatcatcctaaattagaggctgccctggaaactcttcaacgaaatattgaagccaat
ggagtagctgaaaagtgtattgtaacgggtctcgactgggaatcgcgtgcttcagtgtcc
gccgtttgcgatcaaatcggtgatcgtcatctcgatgtgatcatcgcatcggacgtattc
ttcgatccgtccacgttttgcccgctaatcgacacttttgcccaattgttgataaaattc
gaacatgccactatttggtttgcctaccaactgagagatgataattggacctgcgcccca
tatctatcaaaatatccatttctacgtgcaactttggaaagaagaatagagacggaaaaa
gaaacaattgatatttttaaaatgacaagagaatcacttgggctttatgctggaattgaa
ggaggcgctactggctccaaattagtgattatcgacgcagacactaatcagagatacact
tcatcgacagaaggaaccaatttctttttgacggatcacacgatcgtttgcaaacgaata
gctgattggattctggaagttttcgagaaggagaagctggacattaagaatctcaaggct
ctcggtctagggctttctggtgccgaagatgaggaatttaacaagaaattcgttgattac
ttccgtcagaatcatggaaatgtcacggaaaacttctacttgacttccgacgctgtgatg
actcttttggccaattttccaggagaggaaaatgggattgtactgattgctgggaccgga
tcttcgtgtcgactaaaaattcgtgacggatctgtaaaaggagccggcggctggggacat
caaattggagacggaggaagtgcattttggatcgctcgaactgcgatccagatgcttttc
gacgcggaagacgggttcgaggagaactttaatactgatgttatcaaacagctgctcttc
aaacactataatattactgataaaactagaatgctcgactatttgtactctaaatttgag
aagcataaaattgccgattttacagtttctctcgcggaacgaactgacgatgcggctgtg
gcagaagctttcagaagagctggagatgttctcggaaaacatgtgagaactgtggcaaag
tatctcaccaatgaagatcgaaaagttctcagcattgtccagatcggaggagtctttcaa
tcatgggatgctctccaacaaggatttgtggcttctttgagtggatctggaatcgagaaa
atcgtaatgtacgagccatctgattcacctgcggttggcgcagctgtgctcgctgcgaag
gagcggaacgagattttcttgcagcagaatgtagagaaaaagatgctgagggagattaat
ttgtag

DBGET integrated database retrieval system