KEGG   Caenorhabditis elegans (nematode): CELE_W08D2.1Help
Entry
CELE_W08D2.1      CDS       T00019                                 

Gene name
egl-20
Definition
(RefSeq) Uncharacterized protein
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04150  mTOR signaling pathway
cel04310  Wnt signaling pathway
Module
cel_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_W08D2.1 (egl-20)
   04150 mTOR signaling pathway
    CELE_W08D2.1 (egl-20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cel00536]
    CELE_W08D2.1 (egl-20)
Glycosaminoglycan binding proteins [BR:cel00536]
 Heparan sulfate/Haparin
  Morphogens
   CELE_W08D2.1 (egl-20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 177821
NCBI-ProteinID: NP_501754
WormBase: WBGene00001188
Ensembl: WBGene00001188
UniProt: G5EG05
Position
IV:complement(join(9813183..9813278,9813605..9813705,9813765..9813891,9814011..9814154,9814201..9814371,9814421..9814560,9814960..9815042,9815101..9815180,9815234..9815366,9815415..9815521))
Genome map
AA seq 393 aa AA seqDB search
MQFFICLIFLFVLLVYGQYSPPSATYSTQQVPYNWLTLAFVGSNDYLPRPHYHSTDREHF
KELCRRLDGLNPNQQALCAENPFSIPFVARGVREAIRECENKFKFERWNCSSRDEVTETR
HGKFQDILGKTLRSANKEAAFLNAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQAE
SDPSMSRDQFSWGGCSDNVPHGIRYAKKFLDDWETAQFDKTKNVAHLVRRHNNFVGREAI
AQNIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSDLLKKRYDHFAVQVTRKATKRLRRKER
TERKIPLRGNEMAYVHRSPSYCEKNLTAGILGTSGRECIHNSYSSESCDLLCCGRGYNTR
LEIRQTQCECKFVWCCEVKCKTCTEEVAVHTCK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttttcatttgcctgatttttctatttgttctcctcgtttatgggcaatattct
cctccatctgccacatacagtacgcaacaagttccatataactggctaacattggcattt
gtgggttcaaacgattatcttccacgacctcattaccattcaactgatagagaacatttt
aaagaactctgtcgtcgacttgatggcttgaatccaaatcaacaggcactttgcgcggag
aatcccttctcaattccatttgtagctcgcggagttcgtgaagcaattcgagaatgcgag
aataagttcaaatttgagagatggaattgttcgtcaagagatgaggttacagaaactcgt
cacggaaaatttcaggatattttggggaaaacattaagatcagcaaacaaagaagcagca
tttctcaacgcaataatggcagccagcatagttcattctattacaaaaggctgtaatact
ggaaatctaacagaatgtggatgtgacagtaaaccaggaatgcagagatatcaggctgaa
tctgacccatcaatgagtagagatcagttctcctggggtggatgctctgataatgttcca
catggtattcggtatgcaaaaaagtttttggatgactgggaaactgcacagtttgacaaa
acaaagaatgttgctcatcttgttcgacggcataacaattttgttggaagagaggcaatc
gcccaaaatattcgacgtcaatgtcgttgtcatggagtatctggttcatgtgaattcaaa
acttgttggctccaaatgcagaagttctcccaagtgtccgaccttcttaaaaagcgatat
gatcatttcgcagttcaggtaacaagaaaagccactaaaagattacgaagaaaagaacga
acggaacgaaaaattccgttgagaggaaatgaaatggcatacgtacatcgatcaccgtct
tattgtgagaaaaatctcacagcaggaatactgggaacgtctggtcgtgaatgtattcat
aactcgtacagctcagaaagctgtgatttgctttgttgtggacgaggatataacacaaga
ttagagatccgccaaactcaatgcgagtgtaaattcgtttggtgttgtgaagtgaaatgc
aagacttgtaccgaagaagttgcagtacatacatgcaaataa

DBGET integrated database retrieval system