KEGG   Caenorhabditis elegans (nematode): CELE_W08F4.6
Entry
CELE_W08F4.6      CDS       T00019                                 

Gene name
mlt-8
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Other DBs
NCBI-GeneID: 173448
NCBI-ProteinID: NP_493759
WormBase: WBGene00021095
Ensembl: WBGene00021095
UniProt: O02106
Position
II:complement(join(569506..569703,570408..570603,570887..571125,571934..572107))
AA seq 268 aa
MVLLLLLLAVGTVVAQNPLTKAWNEAVPGVQPFWEKYQTGPHGVVIRGWQFSRCASEQWT
NYVVNVSNIVIWPDYPRFPGPIFFNVTMDVSEDLPLDKVEMDLEVRHAVTNKQGSKGWQV
IPCQGWNIIDGCDGVGSCRYCDMLDKCNEAVSGAHKYVKDRKANDFLKQNKLCPPPKGHW
TMTFSKVFSSEDLPKSFFGPLQSNEYWLTFSFTDGKDKKLGCARLWVDVCKYHLQDKSQK
CLRDPNAFKNFINEISSQAEHIRSRNGK
NT seq 807 nt   +upstreamnt  +downstreamnt
atggtccttctgcttctgctccttgccgtcggcaccgtagtcgcccaaaatccactgaca
aaggcatggaacgaggcagtgcccggagttcagccattctgggagaaatatcagaccgga
ccacatggagtcgttatcagaggatggcagttttccagatgtgccagtgagcagtggaca
aactacgtggtaaacgtgtcaaacattgtcatctggccagactatccacgtttcccggga
ccaatctttttcaatgttacgatggacgtaagcgaagatctcccactggacaaagttgaa
atggacctggaagtacgtcacgccgtgaccaataagcaaggatccaagggatggcaggtg
attccatgtcagggatggaatattattgatggttgtgatggagtcggctcgtgccgctac
tgtgacatgctcgacaaatgtaatgaagccgtttcgggagcccacaaatacgtaaaagac
cgtaaagccaacgatttcctgaaacagaacaagttgtgcccaccaccaaaggggcactgg
actatgactttctctaaagttttcagctctgaagatcttccaaaatccttctttggacca
cttcaatcgaatgaatactggctaacattctccttcactgacggaaaagacaagaagctg
ggatgtgcccgtttgtgggtggatgtatgcaagtaccaccttcaggacaagtcccaaaag
tgcctccgtgacccgaatgcattcaagaactttatcaatgaaatttcatcgcaagctgaa
catattcgctccagaaatggaaaataa

DBGET integrated database retrieval system