KEGG   Caenorhabditis elegans (nematode): CELE_W10C8.2
Entry
CELE_W10C8.2      CDS       T00019                                 

Gene name
pop-1
Definition
(RefSeq) Protein pop-1
  KO
K04491  transcription factor 7-like 2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_W10C8.2 (pop-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_W10C8.2 (pop-1)
Transcription factors [BR:cel03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    CELE_W10C8.2 (pop-1)
SSDB
Motif
Pfam: HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 171849
NCBI-ProteinID: NP_491053
WormBase: WBGene00004077
Ensembl: WBGene00004077
UniProt: Q10666
Position
I:complement(join(2823468..2823937,2824877..2825429,2828480..2828598,2830119..2830293))
AA seq 438 aa
MMADEELGDEVKVFRRDEDADDDPMISGETSEQQLADDKKEAVMEAELDGAGRNPSIDVL
KSAFPKVEPMSPSFPGLMSHFSPGYSAAALPMFMPLFMNPYAAALRSPSLMFPMGAMSPT
FPMFPPSPVYGAAIAAAAAKQHFENMAPLNMRAGHPMNQMGMPPYMHPSSMAPQNVDRRA
QGGGKAKKDDHVKKPLNAFMWFMKENRKALLEEIGNNEKQSAELNKELGKRWHDLSKEEQ
AKYFEMAKKDKETHKERYPEWSARENYAVNKKKTKKRRDKSIPSENNDQKKCRARFGVNN
TEMWCKFCKRKKKCEYATDRSGGSDITDSQDGRGTSGAYSSSSESPSPKANAGIALTTQQ
QQAAMMHTMLMQMRLGSTTGASTHVPSPLASSSAGRSPLDANASDSESDVEEEEDEQIDP
TVMQQTHDMLMQESMCTI
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgatggccgacgaagagctcggcgatgaggtgaaggtgttccgtcgggatgaggatgct
gacgatgatccaatgattagtggtgaaacgtcagaacaacagttagccgatgataaaaaa
gaagctgtaatggaagcagaattagacggtgccggtcgaaatccatcgattgatgtgtta
aaaagtgcatttccaaaagtcgaaccaatgtcaccatcgtttcccggtttaatgtcacac
ttcagtcctggatactcggcagctgctttacccatgtttatgcctctatttatgaatcca
tacgcagcagcactacgatcaccaagcctgatgtttccaatgggagcaatgagccccaca
tttccaatgttcccgccaagtcctgtctatggagcagcaatcgctgcggcagccgccaaa
caacactttgagaatatggctccactgaacatgcgagccggtcatccaatgaatcagatg
ggaatgccaccatacatgcatccatcatcaatggctccacagaatgtcgatcgaagggct
caaggaggtggaaaagcgaagaaggatgatcatgtgaagaagccattaaacgcgttcatg
tggtttatgaaggaaaatcgaaaagcactgctggaagagattggaaataatgagaaacag
agtgcagagttgaataaagagcttggaaagaggtggcatgatttgtcgaaggaagaacag
gcgaaatattttgaaatggcaaagaaggataaggaaacacacaaggaacggtatccggag
tggtcggcgcgggaaaattatgcggttaataagaaaaagacgaagaaacgaagggataag
agtattccatcggagaacaacgatcagaagaagtgccgagccagattcggagttaacaac
acagaaatgtggtgtaaattctgcaagcggaagaagaagtgcgagtacgcaactgatcgt
tcgggcggttccgatataactgacagtcaggatggacgaggtacaagtggtgcgtatagc
agtagctcggagagcccatcaccaaaggcaaacgctggaattgcactgaccacacagcag
cagcaagcagcaatgatgcatacgatgttgatgcaaatgcgtctaggatcgacgacggga
gcatcgacgcacgttccatcaccactggcgtcctcgtcggcaggcaggagtccgctggat
gcgaacgcgtcggattcggaatctgatgttgaggaggaggaagacgagcagattgatccg
acggttatgcagcagacacatgatatgcttatgcaggaatcgatgtgtactatttaa

DBGET integrated database retrieval system