KEGG   Caenorhabditis elegans (nematode): CELE_W10D5.1
Entry
CELE_W10D5.1      CDS       T00019                                 

Gene name
mef-2
Definition
(RefSeq) MADS-box domain-containing protein
  KO
K09260  MADS-box transcription enhancer factor 2A
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_W10D5.1 (mef-2)
Transcription factors [BR:cel03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    CELE_W10D5.1 (mef-2)
SSDB
Motif
Pfam: SRF-TF BAF1_ABF1
Other DBs
NCBI-GeneID: 172732
NCBI-ProteinID: NP_492441
WormBase: WBGene00003182
Ensembl: WBGene00003182
UniProt: Q9U325
Position
I:join(9096012..9096065,9098443..9098555,9098608..9099024,9099073..9099296,9099844..9100058)
AA seq 340 aa
MGRKKIQITRIQDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIVFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNNDIMEALNRKEGNQGGGNSDDESPGPSTSPVIQITMPAV
VNGHSSNNSVASAASASAAAVAAAAAAVAAVEGTSSGAAAAAAALQASNAQRHHNLNLYQ
NLIFNPNYTRHLNQRNDPLSSTSVAPSSSSSKHLDFPPSTSFAYDTSRLHPIAAADADCD
LVPSSRAAADQNIWSSALQQRPVSQPAPSISNSSTNGISNGTSSLLSPNVSSLNGHSVLD
LGGPNLPYKLDPNTYVKMEPHSPPEKRPRITTEWRPQQLT
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggtcgcaagaaaattcaaatcaccaggatacaagatgagagaaatcgacaggtgaca
ttcaccaaacgaaagtttggattgatgaagaaagcctacgaattatcggttctctgtgat
tgtgagattgcactcatcgtcttcaactcaactaacaaactatttcaatatgcctcaact
gacatggataaggtattgttgaaatacactgaatacaatgaacctcatgaatcccgtact
aataatgacatcatggaagccttgaatcgaaaagaaggcaatcagggaggcggaaattcg
gatgatgaaagccctggaccatcaacatcacctgtcattcaaataacaatgcctgctgtt
gttaatggacatagttctaataattcggtggcttctgcagcttctgcttctgctgccgct
gttgcagcagcagcagccgcagttgcagcagttgagggaacatcttcgggtgcggctgct
gcagcggctgcactacaagcatcaaatgctcaacgacatcataatttgaacttgtaccag
aatttgatatttaatcccaactacactcgccatttgaaccaaagaaatgatcctctgtcc
tctacatctgttgctccttcctcatcctcatcaaaacatctcgattttcctccatcaact
tcatttgcctatgacacgtcacgccttcatccaattgccgctgctgatgctgattgtgat
cttgtaccatcatcaagagctgcagctgatcaaaatatttggtcatctgcattacaacaa
cgccctgtttcacagcctgcacctagtataagcaattcatcaacaaacggaatctcaaac
ggaacttcatcactcttatctccaaatgtcagctcattaaatggtcattcagtattagat
ttaggtggtccaaatctaccatataaattggatccaaatacatatgtcaaaatggaacca
cattcaccacctgaaaaacgtccaagaattacaacagagtggagaccacagcaattgact
tga

DBGET integrated database retrieval system