KEGG   Caenorhabditis elegans (nematode): CELE_Y105C5B.28
Entry
CELE_Y105C5B.28   CDS       T00019                                 

Symbol
gln-3
Name
(RefSeq) Glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00220  Arginine biosynthesis
cel00250  Alanine, aspartate and glutamate metabolism
cel00630  Glyoxylate and dicarboxylate metabolism
cel00910  Nitrogen metabolism
cel01100  Metabolic pathways
cel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CELE_Y105C5B.28 (gln-3)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CELE_Y105C5B.28 (gln-3)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_Y105C5B.28 (gln-3)
   00220 Arginine biosynthesis
    CELE_Y105C5B.28 (gln-3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_Y105C5B.28 (gln-3)
Enzymes [BR:cel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     CELE_Y105C5B.28 (gln-3)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_Y105C5B.28 (gln-3)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-GeneID: 178452
NCBI-ProteinID: NP_001041009
WormBase: WBGene00001604
Ensembl: WBGene00001604
UniProt: Q9U307
Position
IV:complement(join(16167897..16168245,16168655..16169129,16170073..16170234,16170448..16170621,16170672..16170678))
AA seq 388 aa
MSQMAQSLRSQFATDKQVLQKFLNLDQKGMYQALYIWIDGSGENIRAKTRTFDFEPTDPE
KLPIWNFDGSSTGQAEGADSDVYLKPVAIYPDPFRQGKNKLVMCETYDNKKKPTATNYRQ
RCKEVMEKAADQHPWFGMEQEYTLLDIDGHPFGWPKNGFPGPQGPYYCGVGANKVYGRDI
VEAHYRACLYAGIQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVI
ASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEIMSAINKLSLVHPQHIAYYDPHGGKD
NERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGAL
VRTVCLEGAERKLSMMYVPSQAPNITKH
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtcgcaaatggctcaatcactccgcagtcaattcgccaccgacaagcaggtcctgcaa
aagttcctgaacttggaccaaaagggcatgtaccaggccctctacatttggattgacgga
tccggcgagaacattcgtgccaagaccagaaccttcgattttgagccaactgacccagag
aagctcccaatttggaactttgacggatcatccaccggtcaagccgagggagccgactcc
gacgtctacctgaagccagtcgccatctacccagacccatttaggcagggaaagaacaag
ttggtgatgtgcgagacctatgacaacaagaagaagccaaccgccaccaactaccgccag
cgatgcaaggaggtgatggagaaggccgccgaccagcacccatggttcggaatggagcag
gagtacacccttctcgacattgacggacatccattcggatggccaaagaacggattccca
ggaccacaaggaccatactactgtggcgtcggcgccaacaaggtctacggtcgcgacatc
gtcgaggctcactaccgcgcatgcctctacgccggaatccagatctcgggaaccaacgcc
gaagtgatgcccggacaatgggagttccaggtcgggccatgcgaaggaatccagatggga
gatcagttgtgggtggctcgctacttgctgcaacgtgtcgccgaggagtttggcgtgatc
gcctcgttcgattgtaagccgatcaagggagactggaacggagccggatgtcacaccaac
ttctccactgataagatgagaaatccaggaggaattgacgagatcatgtccgccatcaac
aagctctcccttgtccacccacaacacattgcctactacgatccacacggtggaaaagac
aacgagcgtcgtttgaccggactccacgagaccgcatcgatcgacaagttctcctacgga
gtcgcatcccgtgcctcatccattcgtattccacgctccaccgacgatgatggatacgga
tacttcgaagatcgccgtccatcatccaactgtgacccgtacaccgtcaccggagccctc
gtcagaactgtgtgtcttgagggagccgagcgtaaactgtcgatgatgtatgttccaagc
caggcaccaaatattaccaagcattag

DBGET integrated database retrieval system