KEGG   Caenorhabditis elegans (nematode): CELE_Y105E8A.9
Entry
CELE_Y105E8A.9    CDS       T00019                                 

Gene name
apg-1
Definition
(RefSeq) AP-1 complex subunit gamma
  KO
K12391  AP-1 complex subunit gamma-1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    CELE_Y105E8A.9 (apg-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_Y105E8A.9 (apg-1)
Membrane trafficking [BR:cel04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    CELE_Y105E8A.9 (apg-1)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptinC2 Cnd1
Other DBs
NCBI-GeneID: 173304
NCBI-ProteinID: NP_740937
WormBase: WBGene00000158
Ensembl: WBGene00000158
UniProt: Q8WQB3
Position
I:join(14406043..14406104,14406167..14406371,14406418..14406542,14407342..14408038,14409517..14409777,14411845..14412284,14413506..14413850,14415462..14415729,14417333..14417419)
AA seq 829 aa
MATAVELAIEKIDEYKSKIGRTLGTPMRLRDLIRQVRAARTMAEERAVVDRESANIRESF
RDDDSPWKCRNIAKLLYIHMLGYPAHFGQMECMKLVAHPRFTDKRIGYLGAMLLLDERSE
VHMLVTNSLKNDLTCSTQFVSGLALCTLGSICSAEMCRDLANEVEKIIKQNNAYLKKKAA
LCAFRIVRKVPELMEVFIPCTRSLLGEKNHGVLMGATTLVTEMCEKSPDVLNHFKKLVPN
LVRILKNLLMSGYSPEHDVTGISDPFLQVKILRLLRVLGKDDVRVTEEMNDILAQVATNT
ETAKNVGNAILYETVLTIMEIKSESGLRILAVNILGRFLLNTDKNIRYVALNTLLKTVHV
DYQAVQRHRNVVVECLKDPDISIRKRAMELCFALMNRTNIAIMTKEVLIFLETADAEFKS
ECASRMYIATERYSPNHEWHLDTMITVLRLAGKYVPDEVVSCMIQMISANEQLQSYAVSQ
LYHAAQKDAINAQPLLQVAFWTIGEFGDLLLQPTDVDSTPISENDVVGVFESVLPSALTS
LWTKCYGVTALAKLGTRFQSTGDRIGALVRMNQAHIQLELQQRSVEFNVILNLGDLRDGL
LERMPVITHNSLNAAAPSMIDEEVSAESGAPVVTNGDLLGDLNLGGGGSTNPSNDYSSDL
LGVGVGSGAASAQAPPPPPPPTSNSNILDIFGDTPSSNAAGGFDFGMAAPAKEPTYQPVI
AINKGGIEVQLQVIETWKNEKARLRMTAYNYTPRTLSNYNFFAAVTKTFEIALEPASSPN
IDPNEHTTQFMTITRKAPNTTARMRTKISYIVDGTEQVGEGVVNEFPGL
NT seq 2490 nt   +upstreamnt  +downstreamnt
atggcgacggctgtcgagctagccattgagaagatcgatgagtataagtcgaagattgga
agaactctcggcactccgatgcggcttcgagacctaattcggcaggtcagagcggcacga
acgatggctgaagagcgagcagtggtggatagagaaagtgcgaatattcgagaaagcttc
cgagacgatgattctccgtggaaatgtagaaatatcgcgaaattgctctatattcatatg
ctcggctacccagcgcattttggacagatggagtgcatgaaactggtggctcacccccga
ttcactgacaaacgaattgggtatcttggagctatgcttcttctcgatgaacgatcggaa
gttcatatgctcgtcactaattcgcttaaaaacgacctcacctgttccacccaattcgtc
agcggactagctctctgcactctgggctcaatttgctcagcggaaatgtgtcgagacctg
gccaacgaggttgagaagatcatcaagcagaacaatgcgtatttaaagaaaaaagcggcg
ctctgtgcgttccgtatcgttcgaaaagtgccggagctgatggaagtcttcattccatgt
acccgatcgcttctgggagagaaaaatcacggagttttgatgggcgcaacgactttggtc
acagaaatgtgcgagaaatctccggatgtcttgaatcattttaagaaattggtgccgaat
ttggtacggattctaaagaatcttctaatgagtggatattcgccggaacacgacgtcacc
ggcatctctgacccgttccttcaggtcaaaattctgagattattgagagttttggggaag
gatgacgtacgtgtcactgaagagatgaatgatattctggcgcaagtggcaacgaatacg
gaaacggcgaaaaatgtcggaaacgcgattctctatgagactgtactcacgattatggag
attaagagcgagagtggcctgcgcattttggctgtgaacattcttggacgattccttttg
aatacggataagaatattcgatatgtggcgttgaatacgcttctgaagactgttcatgtt
gattatcaggccgtacaacgtcaccgtaacgtagtcgttgaatgtctcaaagatccggat
atttcgatcagaaaacgtgcaatggagctctgctttgctctgatgaaccgtacaaatatc
gcaataatgacgaaagaagtgctcattttcctcgagaccgccgacgctgaattcaaatcg
gaatgtgcttcacgaatgtatattgcaacggaaagatattcgccgaatcatgaatggcat
ttggatacgatgattactgtacttagattggccggaaaatacgttcctgacgaggtggtc
tcctgtatgatccaaatgatttcggcgaatgagcaactgcagagctatgcagtatcccag
ctttaccatgccgctcaaaaagatgcaatcaatgctcaaccactgcttcaagtagctttc
tggacaattggagaatttggagatttgttacttcaaccaacagacgttgatagtactcca
atctctgaaaatgatgttgtcggagtatttgaatcggttcttccgtctgctctaacctca
ctttggacaaaatgttatggagttactgctcttgcgaagctgggaaccaggttccagtcg
actggagatcgaattggagcacttgttcgtatgaatcaggctcatattcagttggagtta
cagcagcgatctgtggaattcaatgtgattttgaatttgggagatttgagagacggactg
ctcgaacgaatgccagtaatcacccataattccctaaatgccgctgctccatcaatgatc
gatgaggaagtttctgcagaatcgggagcaccagtagtaaccaatggagatctccttggt
gatctgaaccttggtggtggtggttcaacgaatccatcaaatgactatagttctgatctt
ttgggtgttggagttggtagtggagcagcttctgctcaggcaccaccaccaccaccacca
cctacctcaaattcgaatattttggacattttcggcgatacaccatcttcaaatgctgct
ggtggttttgactttggaatggctgctccagcgaaggagcccacttatcagccggtaatc
gctatcaacaagggcggaatcgaagttcaactgcaagtcatcgaaacgtggaaaaacgag
aaggctcgtctgagaatgacggcttacaactatacaccaagaactctttcgaactataat
ttcttcgcagccgtcacaaaaacgtttgaaattgcactggaaccggcttcatcgccaaat
attgatccaaatgagcatactactcaatttatgactattacaagaaaagcacctaatact
actgctcgcatgcgcaccaaaatctcgtacattgtcgacggaacggaacaagtcggcgaa
ggagttgtcaacgagtttcccggattgtaa

DBGET integrated database retrieval system