KEGG   Caenorhabditis elegans (nematode): CELE_Y16B4A.2Help
Entry
CELE_Y16B4A.2     CDS       T00019                                 

Gene name
Y16B4A.2
Definition
(RefSeq) Carboxypeptidase
  KO
K13289  cathepsin A (carboxypeptidase C) [EC:3.4.16.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    CELE_Y16B4A.2 (Y16B4A.2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cel01002]
    CELE_Y16B4A.2 (Y16B4A.2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_Y16B4A.2 (Y16B4A.2)
   04131 Membrane trafficking [BR:cel04131]
    CELE_Y16B4A.2 (Y16B4A.2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_Y16B4A.2 (Y16B4A.2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.5  carboxypeptidase C
     CELE_Y16B4A.2 (Y16B4A.2)
Peptidases [BR:cel01002]
 Serine Peptidases
  Family S10
   CELE_Y16B4A.2 (Y16B4A.2)
Chaperones and folding catalysts [BR:cel03110]
 Intramolecular chaperones
  Other peptidases
   CELE_Y16B4A.2 (Y16B4A.2)
Membrane trafficking [BR:cel04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    CELE_Y16B4A.2 (Y16B4A.2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_Y16B4A.2 (Y16B4A.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S10 DUF1100
Motif
Other DBs
NCBI-GeneID: 181572
NCBI-ProteinID: NP_510452
WormBase: WBGene00012445
Ensembl: WBGene00012445
UniProt: K8ESM2
Position
X:complement(join(14762036..14762407,14762452..14762571,14762619..14762730,14762777..14762845,14762892..14763034,14763086..14763205,14763253..14763379,14763426..14763688,14763738..14763827,14763882..14764044,14764093..14764256,14764302..14764511,14764856..14765381,14765429..14765572,14765620..14765711,14765759..14765932,14765983..14766069,14766396..14767040,14767088..14767165,14767222..14767417,14767470..14767612,14767659..14767808,14768145..14768286,14768334..14768425,14768503..14768766,14768818..14769072,14769175..14769351,14769558..14769852,14769899..14770047,14770095..14770176,14770586..14770711,14770758..14770849,14770987..14771410,14771491..14771561,14771696..14771824))
Genome map
AA seq 2161 aa AA seqDB search
MAAHQILLLCLLLLLAPLRNGQTTPTTRAQADLVNQLPGTIFQVNFKQYAGYLNSDPNKN
YNNLHYWLIESQLTPSNDTLLLWINGGPGCSSVFGQIQEIGPFHVSSDSQTVYENVFAWN
KVSNLLAIDGPGAGFSWQQNLFQDDSYVTGALLNALMDFYTVYPNMLNSDLYIAGEGYGS
FFASSLVESLMVNNTPRPDIVTSPVNIRGLLLANGDLSARLQYNSLIPFYYTHGFAGSKQ
YDDLKSVCCTNASTQTCDFFNSNTACRTKADNAIATWSNYQIDNTNINEDCYRNQAAWQT
SFKQLGINAAVDNYNSTDSFRGYPCFALSATAAYLNRQDVQAALHVSVNASTNFQTCRNL
TYGELSTDLQIRISSILTSEKYAQNNMKIMIYNGDLDLWSNFIGAQRFGQEIAAALKLNT
TEDRIWRHNYDSAAFVWMDGGVITSYSSNFHIASIRGGGHFAPQNRPSQSLQLYRDFVLG
LFFNNCLSRVNKVAAPLLPAYQQLAAPATRRDADKIVNLPGLTYQINFNQYSGYLNASDT
HRFHYWFVESQNDPTNSPVLLWLNGGPGSSSLWGMLTENGPFRPNKDGQTLYENVHSWNK
FANVLYLESPHQVGYSYSTVANDYTYGDDLTASDNYNALKDFFNNIFPQYKQNPFYITGE
SYGGVYIPTLSKLLLQMLSAGEININFKGIAIGNGELTTKLQVNSAIFQLYTYGLFGENE
YNALVARCCKNVTDPTQCDFYTPYVFFDYLGNYKAVDGADPFCSSTILGVVNDQVWNSAN
NPYNIYGDCYTTSASSSSSSSSKSNKQNRAAVRDNAGLLNLASSDPFDGFPCWSTDATTT
YLNRDDVRNALHIPTTVQQWQSFNQTVNAQLYNRSYFELDAVLNRILSSYYYKQNNMKIL
IYNGDVDMVCNHLGDQWLIEQVASNAGLKTVSPRQPWNYVMAGQNYLPQLAGYVKVFDSN
LNLVTVKGSGHLVPQDRPGPALQMIFNFISGVNLNTTFPYALPAAPLLPAYSDLQGCQAP
QYPTAQSLPTLPPLPPLPPGVTYPFVAKKDVVEVAEPGTIAADEHGSQIYPTALNDAAKA
DMILSLPGLTFNVTYRMFSGYLTADETPLNHLFYWFVESQNDPVNDPVVLWLNGGPGCSS
LGGFFTELGPFHPNDDGGQTLYENVFSWNKKANVIFLEAPAKVGFSYTEDPNYYWDDDTT
AQNNGYAIKSFFQKKFPQYAQNQFFITGESYGGVYCPTLTLNLVQQIDAGILNLNFKGTA
VGNGILSEYLQTNSEIVLQYGRGFNGVDDWNNLKTACNLTNSDTIYYDYQGAPEGSACYQ
AVDDNQKKFYGLDERYGDPYNMYQDCYLYNNKGAWQTPSAQQQTKPKTRRERALRAHMNR
RKSFASASIKFDNSNSKNWYGSTDPFRGLNCFAGDALVTYLSRDDVQTAIHSRKQPLWVD
CADENPANHFRYHTQEKYYDMQNTISDIMDSKWYTQNSMRLMFYNGDVDTICQFLGDQWL
IEKLVTRRNLTVTSPRQPWYYQQGSQYVTTIAGYAKSWTQNLVQLTVKGSGHFVPSDRPA
QALQMLTNFLSNQANYSTPAGIDVTPQPLTNVISQTNCTTGQTDRIINLPGLPADMLFKQ
YSGFLDGLSGHKVHYWLVESENNPSTDPLLLWLNGGPGSSSLMGLFEENGPFRVSKDSQT
LSRNPYSWNKFANVLYLESPIGVGYSYAYNNTNIQYDDVTTAQENYAALKSFFAQYPQYT
TSDFYTTGESYAGVYLPGLSALLVQGIKSGDININYKGVSIGNGVIDKRTDMNSQLHYQY
YHGGISATTYNTALQLCCSGDEFKCRFSDRMTNFNNSIPWGDLSDPCYDFVVATGAQLLL
TAFDPYNMYQQCWTIPYNDTTPRTPYGETWTGINYESSDFLNGYPCYDDSAMEGYLNRPV
VRKALNIPDSVPYWAANNNIINAYNQQVDSIVPNLQIIMANAPANFKMLLYSGDADTMVN
WLGAEIFTANNFAALGLTTSSPRAQWTFQYNSTFQPTVAGYQTSYTSNAINIDVLTVKGS
GHFVPLDRPQQALQMIYNFVKSRGYNTPFDLNSNFTTTTTTSTTTTTPGTGPTVTAAQTT
TTTPSTPGAGTTGTPGTGPTVTAAPTNGISTTQPIITTTKGAEGRGVLTIMATILSVLLF
N
NT seq 6486 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcatcaaattttactcctttgtttgttactactattagcgccgttgcggaat
ggacaaaccacgccgaccacgagagcccaggccgatttggttaatcaactgccagggact
atttttcaggtgaacttcaaacagtatgcgggttacctcaactctgatcccaacaaaaac
tacaacaatcttcactattggttaatcgaatctcaactgaccccttccaatgatacgctc
cttctttggattaatggaggtccgggatgtagttcagttttcgggcagatccaggaaatc
ggcccattccatgtgtctagtgatagtcagacggtgtatgaaaatgtgtttgcttggaac
aaggtgtccaatttgcttgccatcgacggtccgggcgccggcttctcatggcaacaaaat
ctctttcaagacgacagctacgtaactggtgctcttcttaacgctctcatggatttctat
acggtgtatccaaatatgctaaactctgatctctacattgctggtgaaggatacggatct
ttctttgcttcgtcgttggtagaatctctgatggtgaataacactccaagaccggacatt
gttacctctccagttaatattcgaggacttcttcttgcaaatggtgacttgagtgctcgc
ctccaatacaacagtctcatcccattctactacactcatggatttgccggatcaaaacaa
tatgacgatctcaaatcagtttgttgcacaaatgcttccacccaaacttgcgattttttc
aacagtaacacagcatgcagaaccaaagctgacaacgcaattgccacttggtcaaattat
caaattgacaacacaaacatcaacgaagactgctacagaaaccaagctgcatggcaaaca
tccttcaaacaacttggaattaatgcagctgtagataactacaactcaacggactcattc
agaggatatccatgctttgcactttcagccaccgccgcttatttaaacagacaagatgtt
caagctgcacttcatgttagtgtgaatgcaagtacaaacttccagacttgcagaaatctg
acatacggagaactctcaacggatttgcaaatccgaatttcctcaattctaacatccgag
aagtatgctcaaaataacatgaaaatcatgatctacaatggagatctggatctctggagc
aactttattggtgctcaaagatttggacaagaaattgcggcagctctcaagttgaacaca
accgaggatcgcatttggagacataactatgattcggcagcatttgtgtggatggatggt
ggagttattactagttactcgagcaattttcatatcgcatccattagaggtggcggtcac
ttcgcaccacaaaaccgtccgtcacaatcgctacaactatatcgcgacttcgtcttagga
ctgtttttcaacaattgcctcagccgagttaacaaagtcgccgcgccattgctgcccgct
tatcaacaacttgccgcgccagctactcgtcgtgatgctgataagattgtgaatctacca
ggactcacataccaaatcaatttcaatcaatactcgggatacttgaacgcttcagacacc
caccgtttccactattggttcgtagaatctcagaatgaccccaccaacagcccagtgctg
ctctggttgaatggtggacctggaagttcttccctatggggaatgctcacagaaaacgga
ccattccgtccgaataaagacgggcaaacattgtatgagaatgttcactcctggaataaa
tttgccaatgttctctacctcgagagtccacaccaagtaggatactcatactcaacggtt
gctaacgattacacttatggagatgacttgactgcttcggacaactataacgctctcaaa
gactttttcaacaacatcttcccacaatacaagcaaaatccattttacatcaccggagag
tcatatggtggagtatacattccaaccctgtcgaagctccttctgcagatgctcagtgcc
ggagaaattaacataaactttaagggaatcgccatcggtaatggagaattgactaccaag
ctgcaagtgaactctgctatcttccaactctacacatatggacttttcggagaaaatgaa
tacaacgctcttgttgcaagatgttgcaagaatgtgactgacccaactcaatgtgatttc
tacaccccatacgtcttcttcgactatcttggcaactacaaagcagttgacggagctgat
ccattctgttcttccacaatccttggtgttgttaacgatcaagtctggaactctgccaac
aatccgtacaacatctatggtgattgttataccacatctgctagttcttcttcttcctca
tcctccaaatccaacaagcaaaaccgagcggcagtcagagataacgctggactgttaaac
ctcgcctcatctgatccttttgatggattcccgtgctggagtactgatgcaacaacaact
tatttgaaccgagacgatgttcgaaatgcactccatattccgaccactgtgcagcagtgg
caatctttcaaccaaaccgtcaacgcacagctctataatcgcagttatttcgagttggac
gcagttttgaatcgtattctgtctagctattactacaaacaaaataatatgaaaatcctg
atctacaacggagatgttgatatggtgtgcaatcatcttggagaccaatggctgattgag
caggttgcaagtaatgctggattgaagaccgtttctccacgtcagccatggaattatgtg
atggctgggcaaaactatcttccacagcttgcaggatatgtgaaggtgttcgattcgaac
cttaaccttgtcactgtcaaaggatcaggacacttagtaccacaggatcgtccaggacca
gcattgcaaatgattttcaactttatcagtggcgtcaatttgaacactacattcccatat
gctcttccggcagcaccacttcttccagcttatagcgatcttcaaggatgtcaagcccca
caatacccaactgctcagtctcttccaactctaccgccacttccaccacttccaccaggt
gtcacctatccatttgtggctaagaaggatgtagtggaggtagcagaacccggaaccatc
gcagctgatgaacacggatcccaaatctacccaacagcattgaatgatgccgctaaggct
gatatgattctgagcttgcctggactaacatttaatgtgacttatcgcatgttctccgga
tacctgactgctgacgaaactccactgaaccatttgttttattggtttgttgaatctcaa
aatgatccggtgaatgatccagttgtattgtggcttaatggaggtccagggtgcagttct
ttaggtggattcttcacagaacttgggccattccatccaaacgatgatggtggtcaaact
ctttacgaaaatgttttctcctggaataagaaagcaaatgttatcttcctcgaggccccg
gcaaaggttggattctcatataccgaagatccaaattactattgggatgatgatactact
gctcaaaacaacggatacgccatcaaatcattcttccagaagaagttcccacaatacgcc
cagaatcaattcttcatcacaggagagtcatacggaggagtctattgcccaacgttgaca
ttaaacttggtccaacaaattgacgccggaattttgaatttgaattttaagggaaccgct
gttggaaacggaattctcagtgaatacttgcaaacgaattcggaaattgttcttcaatac
ggacgaggattcaatggagtggatgactggaacaacttgaaaacagcatgcaacttgaca
aactccgatacaatctactatgactaccaaggtgctcccgaagggtctgcgtgctaccag
gcagttgatgataatcagaaaaaattttatggcttggatgagagatacggagacccatat
aatatgtaccaagattgctacctttacaacaacaaaggagcatggcaaacaccatctgct
cagcaacaaaccaaaccaaagactcgtagagaacgtgctctaagagcccatatgaaccgt
cgcaagtcgtttgcttctgcatccatcaaatttgataactccaactctaaaaattggtat
ggatcgactgatccgttccgtggactcaactgttttgctggcgacgcactcgtaacctac
ctctctcgtgacgatgtgcaaaccgcaattcattcaaggaagcaacctctctgggtagac
tgtgctgacgagaacccagcaaatcactttagataccatacccaagagaagtactacgac
atgcaaaacacaattagtgatattatggattccaaatggtacactcagaacagtatgaga
ctcatgttctacaacggagacgtggacaccatctgccagttccttggagatcagtggttg
atcgaaaagctggtgacaagacgtaatttaacggtaacttctccacgtcaaccatggtac
taccaacaaggaagccaatacgttacaaccattgctggatatgccaagtcttggactcaa
aacttggttcaactcactgtcaagggatcaggtcatttcgttccttctgatcgtccagct
caagctcttcaaatgctcaccaatttcttgagcaatcaggctaattacagcactccggct
ggaattgatgtgacccctcagcctctgaccaatgtgatttctcaaactaactgcacaact
ggacaaactgatcgtatcattaatctgcctggtcttccagctgatatgttgtttaagcaa
tattccggatttttggatggactttcaggacacaaggttcattattggcttgttgaatct
gaaaacaacccatcaaccgatcctcttttgctctggctcaatggtggacctggatccagt
tctttgatgggattgttcgaagagaacggtccattccgtgttagcaaggactcgcagaca
ctttctcgtaacccatattcatggaacaagtttgctaatgtcttgtacttggaaagtcca
attggagttgggtattcctatgcctataacaacaccaacattcagtatgatgatgttacg
accgctcaagaaaactatgctgctctcaagagcttctttgctcaataccctcaatacact
acatctgatttctacaccactggagaatcctatgctggagtttatctcccaggactttct
gctcttcttgtacaaggaatcaaatctggcgatattaatattaactacaagggagtttcc
attggaaacggagtcatcgacaagagaactgacatgaattctcaacttcattaccaatat
tatcatggtggaatttctgcaacgacttacaacactgccttgcagttgtgctgctctgga
gatgagttcaagtgcaggttcagcgaccgtatgacaaacttcaacaactcgattccctgg
ggagacttgagcgatccatgctacgactttgtcgtcgctactggagctcaacttctgttg
accgcttttgatccatataacatgtaccaacaatgctggactattccgtacaatgatact
actccacgtactccatacggagagacttggaccggaatcaactatgaatcgtccgatttc
ttgaatggttacccttgctatgatgacagcgcgatggagggatacttgaaccgtccagtt
gttagaaaagcactcaacattccagattccgttccatactgggctgctaacaacaacatt
attaatgcctacaatcagcaagtggatagcattgttccaaatcttcaaatcatcatggca
aacgctcctgcaaactttaagatgcttttatacagtggtgatgctgacaccatggtgaac
tggcttggtgcagaaattttcacagctaacaattttgcggcattgggacttactacatca
agcccaagagctcaatggacattccaatataacagtaccttccaaccaacagttgctgga
taccaaacttcgtacacttcaaacgctattaatattgatgtgctcactgttaagggctcc
ggtcacttcgtgccacttgatcgtccacagcaagctcttcaaatgatctacaactttgtg
aagtccagaggttacaacactccattcgatctaaatagcaattttactacaacaacaaca
acatccaccaccacaacaacaccaggaactggacctacagtaacagcagcccaaaccacc
acaacaacgccaagcactccaggcgccggtactacaggaacaccaggaactggacctaca
gtaacagcagcaccaacaaacggcatttcaactacacaaccaattattacaacaactaaa
ggtgctgaaggcagaggagtcttgacaattatggctacaattctttcagttttattgttc
aattaa

DBGET integrated database retrieval system