KEGG   Caenorhabditis elegans (nematode): CELE_Y17G7B.7
Entry
CELE_Y17G7B.7     CDS       T00019                                 
Symbol
tpi-1
Name
(RefSeq) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00010  Glycolysis / Gluconeogenesis
cel00051  Fructose and mannose metabolism
cel00562  Inositol phosphate metabolism
cel01100  Metabolic pathways
cel01200  Carbon metabolism
cel01230  Biosynthesis of amino acids
Module
cel_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cel_M00002  Glycolysis, core module involving three-carbon compounds
cel_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_Y17G7B.7 (tpi-1)
   00051 Fructose and mannose metabolism
    CELE_Y17G7B.7 (tpi-1)
   00562 Inositol phosphate metabolism
    CELE_Y17G7B.7 (tpi-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_Y17G7B.7 (tpi-1)
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CELE_Y17G7B.7 (tpi-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CELE_Y17G7B.7 (tpi-1)
  Exosomal proteins of bladder cancer cells
   CELE_Y17G7B.7 (tpi-1)
  Exosomal proteins of melanoma cells
   CELE_Y17G7B.7 (tpi-1)
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-GeneID: 174844
NCBI-ProteinID: NP_001366651
WormBase: WBGene00006601
Ensembl: WBGene00006601
Position
II:complement(12036835..12039139)
AA seq 247 aa
MTRKFFVGGNWKMNGDYASVDGIVTFLNASADNSSVDVVVAPPAPYLAYAKSKLKAGVLV
AAQNCYKVPKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHALEAGI
KVVFCIGEKLEEREAGHTKDVNFRQLQAIVDKGVSWENIVIAYEPVWAIGTGKTASGEQA
QEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLVGGASLKPDFV
KIINARS
NT seq 744 nt   +upstreamnt  +downstreamnt
atgactcgcaagttcttcgtcggaggaaactggaagatgaacggagactatgcctccgtc
gatggtatcgtcaccttcctcaacgcctcagccgacaattcctccgttgatgtcgtcgtt
gctccaccagctccatatctggcctacgctaaatccaagcttaaagccggtgtgcttgtc
gccgcacaaaactgctacaaagtgccaaagggagcattcaccggggaaatttcgccggca
atgatcaaggatcttggattggaatgggtgatcctcggacactcggaacgtcgtcatgtc
tttggagaaagcgatgctctgatcgctgagaagaccgtgcatgctctcgaggctggaatt
aaggtcgttttctgcattggggagaagctcgaggagcgtgaagccggacacaccaaggat
gtaaacttccgtcaacttcaagccatcgtcgacaagggtgtcagctgggagaacattgtg
atcgcctacgaaccagtttgggccatcggaaccggaaagactgcttctggagaacaagcc
caggaggttcatgaatggatccgtgcattcctcaaagagaaggtctcaccagctgtcgcc
gatgccacgagaatcatttatggaggatctgtgactgctgacaatgcggctgagcttgga
aagaagccggatatcgatggattcttggtcggtggagcatcgttgaaacccgattttgtc
aagattatcaacgccagatcttaa

DBGET integrated database retrieval system