KEGG   Caenorhabditis elegans (nematode): CELE_Y17G7B.9
Entry
CELE_Y17G7B.9     CDS       T00019                                 

Gene name
cyn-16
Definition
(RefSeq) PPIase cyclophilin-type domain-containing protein
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cel03041]
    CELE_Y17G7B.9 (cyn-16)
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_Y17G7B.9 (cyn-16)
Enzymes [BR:cel01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CELE_Y17G7B.9 (cyn-16)
Spliceosome [BR:cel03041]
 Complex C
  Other components
   PPlases
    CELE_Y17G7B.9 (cyn-16)
Chaperones and folding catalysts [BR:cel03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    CELE_Y17G7B.9 (cyn-16)
SSDB
Motif
Pfam: Pro_isomerase DUF4525
Other DBs
NCBI-GeneID: 174843
NCBI-ProteinID: NP_496562
WormBase: WBGene00000892
Ensembl: WBGene00000892
UniProt: Q9XXI7
Position
II:complement(join(12028911..12029150,12029828..12030015,12031010..12031098,12031302..12031384,12031948..12032136,12033840..12034250,12035044..12035117,12035248..12035383,12036694..12036735))
AA seq 483 aa
MSNQYINEPITTGKVTLETTAGDIEIELWTKEAPLACRNFIQLCMENYYKGTVFHRLVKN
FILQGGDPTATGTGGESIYGKPFKDEIHQRLKFNRRGIVGMANAGRDDNGSQFFFTIGDR
GAPELDKKHTIFGKVTGPTLFNMLKITEVETEGDRPVTFYKITGARIDNNPFDDLKPREK
RKKEKSERRKEPKVVETKKTNLLSFGDEVEEDEQELAVFNKKTANKPKSAHDAHDNDTVG
LSKQAAVTRDEMSNYCPEDDDTVKDESSISSIREKLMKKSQKRKLEEKAGGEDEDYEKMI
EDERNAKERETIDKMNSELKDMQKEYMKALRPVKEKKKAVKDETLSEAMQSYHDLKMRFK
SKTKDVVKQKDAQREGQTMNMLERFKNRLGASNQKAILFDKKIEIKEPILRNEGEEGEEK
KFGTMDLDAEDIQGTSWMSHRFKAEDVVLSSKAKDANMREESEDWYHITDPRNKMAKRRR
GEE
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgagtaatcaatatatcaacgagccgattacgacgggaaaggtaacccttgaaaccact
gccggagacattgaaattgagctttggacgaaggaagctccactagcatgcagaaatttc
atccagctttgcatggaaaattattacaagggaactgtatttcatcggcttgtcaaaaat
ttcattctccagggtggagaccctacggcaaccggaaccggcggagagagcatctatgga
aaaccatttaaggatgaaatccaccaacgtctaaaattcaaccgccgcggaattgttgga
atggcaaatgctggacgagacgacaacggttcccaattcttcttcacaatcggtgatcgc
ggagctccagagctcgacaaaaagcacacaatcttcggaaaagtgaccggacccacactt
ttcaatatgcttaaaatcacagaagttgagactgaaggcgatcgaccagtgacattttat
aaaattactggagcacgaattgataataatccatttgatgatttaaagccacgggaaaag
aggaaaaaagagaaaagtgagcggagaaaagagccgaaagttgtggagacgaagaagacg
aatttgttgtcatttggagatgaagttgaggaggatgagcaagaattggccgtttttaat
aagaaaaccgcgaacaagccgaaatccgcccatgatgctcatgacaatgacactgttggc
ctatcgaaacaagctgcagtgacacgtgatgaaatgagtaattattgtccagaagatgat
gatactgtcaaagatgaatcgtcaatttcgtcgattcgggaaaaattgatgaaaaagagt
cagaagagaaagctcgaagaaaaagccggcggtgaagatgaagactatgagaaaatgatt
gaagacgagaggaatgcaaaggagcgggagacgattgataaaatgaattcggagctgaag
gatatgcaaaaggagtacatgaaagcacttcggccagtgaaggagaagaagaaggctgta
aaagacgaaacgctgtcagaagcaatgcaatcatatcatgatctaaaaatgcgattcaag
tcgaaaacgaaggatgttgtaaagcaaaaagatgctcaaagagaaggacaaactatgaat
atgcttgaaagattcaaaaatcgattgggtgcttctaatcagaaggctatcttgtttgat
aagaaaattgagataaaagagccaattctccgaaacgaaggcgaggagggcgaagagaaa
aagttcggaacgatggatttagacgcagaagatattcaaggaacatcatggatgtctcat
cgatttaaagcagaagatgttgtactttcttcaaaagcaaaagatgcgaatatgcgtgaa
gaaagtgaagattggtatcatattactgatccacgtaacaagatggccaaacgaagacgt
ggcgaagaataa

DBGET integrated database retrieval system