KEGG   Caenorhabditis elegans (nematode): CELE_Y32G9A.4
Entry
CELE_Y32G9A.4     CDS       T00019                                 

Symbol
srp-3
Name
(RefSeq) SERPIN domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Serpin DUF2067
Other DBs
NCBI-GeneID: 178672
NCBI-ProteinID: NP_503528
WormBase: WBGene00005644
Ensembl: WBGene00005644
UniProt: G5ECY2
Position
V:join(1908909..1909183,1909688..1910183,1910227..1910382,1910429..1910590)
AA seq 362 aa
MFDVAERRFALNFLNTLPVHNESLVFSPLSIALVLSLVHTGVRGSSRDQIRNTLLSGATD
EQLVEHFSFVSKEVKNGTKGVEVYLANKVYLKKGFTVNPTFLSTALKNYGADAKSLDLTT
PAAVQEINSFVNTATNGKIKNIATQDSIKDAIALLINSIYFKADWDDKFDGMSVSEQDFT
LHTGEKKKIKFMKEFMNDRSFSSDDVFDVLHVAYSDQRYQFSVFLPKLRNSLKEALKKLN
EKRFNDLLKTKKRTFMNTQLPKFTIEKDLNLKSHLQTLGITDIFSDSADLSGLAENLKIS
EGVHKAIIEVNEEGTTAAAVTMMKAVPMSARMEQPVNFIADHPFFFTITFLNHPIFVGVF
NG
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtttgacgtggcagagcgtcggtttgctctgaactttttgaacactttgcctgtgcac
aatgagtccctagtattttcacctctttcaattgccctagtcctgtctttggtccacact
ggagtccggggatcttcacgagatcagatcaggaatacgttgctaagtggtgccactgac
gaacagcttgtggagcatttttcgtttgtctccaaagaggtgaagaatggaacaaaagga
gttgaggtttatttggcaaacaaggtttacttgaaaaaaggattcaccgtgaatcctaca
ttcctatcaaccgcactcaaaaattatggcgctgatgcaaaatccttagacctgactacc
ccagctgctgttcaggaaatcaactcatttgtcaacaccgcaactaacggaaaaatcaaa
aacattgctacccaggactcgatcaaagatgcaattgctctgttgatcaactcaatttac
ttcaaggcagattgggatgacaaattcgatggaatgtctgtcagcgaacaggacttcact
ttgcacaccggagagaaaaagaagataaagtttatgaaggaattcatgaacgaccgttca
ttctcttcagatgatgtctttgatgttcttcacgtggcctattcagatcaacgctatcag
ttctcagtattccttccgaaacttagaaactcgttgaaagaagctctgaagaaattgaat
gagaagaggttcaatgacttgctgaaaacaaagaaacgaacctttatgaatactcaactt
ccgaaattcacaatcgagaaggatctgaacttaaagtcccatttgcagaccttgggaatc
actgatattttctctgactctgcggacttatccgggttagctgaaaatttaaaaatttcg
gagggagttcacaaagcgatcatagaggtgaacgaggaaggtaccactgccgctgccgtg
acgatgatgaaagcagttccgatgtctgcaagaatggagcaaccagtaaactttatagca
gatcatccattctttttcacaattacttttttgaatcatcctatttttgtaggggttttc
aatggttga

DBGET integrated database retrieval system