KEGG   Caenorhabditis elegans (nematode): CELE_Y37D8A.13
Entry
CELE_Y37D8A.13    CDS       T00019                                 

Gene name
unc-71
Definition
(RefSeq) Disintegrin and metalloproteinase domain-containing protein unc-71
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Reprolysin Pep_M12B_propep ADAM_CR Disintegrin EGF_2 Reprolysin_4 Reprolysin_3 TMEM51 UPF0239 UPF0560
Other DBs
NCBI-GeneID: 176706
NCBI-ProteinID: NP_499680
WormBase: WBGene00006804
Ensembl: WBGene00006804
UniProt: G5EFD5
Position
III:complement(join(12881193..12881745,12883188..12884464,12885170..12885679,12886889..12886960,12889331..12889974,12891535..12891607))
AA seq 1042 aa
MICASKITMLGLLVMCTLGGVLGKVDIRQTTANKAFMETMRADGYEVVHPFQIRDKNERI
GIDTRNYFLKAQEHYSHVTIVIRSNQLGRLKLVLERNNFIFLNQTAFHKLDADGERVIQN
RVENCYYQGTVGGEESSFVALSSCNGLRGVISFANGTTFGIWPLDGGDRNSRRHPHILYK
SEWSQEAKCGSSMAHAVGQRRMKKHVHKHRSHHHEHNKKRDVSKRTKYVEVALIADYEFM
KARGLHDLDAISYMLESLNIADSMLSRDLNIRLSAVYVELWTDVQRIDLWEDIERTLSGV
VDYASGHIYHIQKDASILFTAGSFANQEVSNAAIRSICTARSAVIVKGVEQFATHWNGEL
LAQSIGHLLGLEHDTTACSCEPSPECVMRQQPGRVGGGGGSPFSWQFSKCSVARMHGIWQ
DGNIQCLLNKPFQVSELRECGNGVVDGSEECDCGSRENCQDPCCDPLTCTLRPHAQCAAH
HKCCHRCELRKAGDTCRSSKSPCDVAEQCDGKSGDCPPDGHLIDGTVCGTDGQCWRGNCS
DSHQQCQKLWGREARVAEPVCFEQNTKGAEYANCGQRQADGTYHPCQIEDTRCGTLHCHS
GSITPIDSSLKAFTFHFTENSHQIQCKSIASAAVGLTSDGTNCASGRVCVAGSCVEMSSV
SSATACPTNNLALLCSGHGHCTTTARCVCFNGWSGVACDIRSNSSTYQGSMGFGEEGSGG
SSQKSSERKTIMIPHLNIGTTLETATLFAILLGFGVFLLLCLVCLMLCYRRRSVVEIPKP
SDEKDEESPDRQIKFGNMPSYREEKRKRKSNKKIYGALNRITEADERDSTSLRSRDSAGG
SQQLVDRRNGAPVVVGGIRDPYAGEHIYAESSSNHLTRQFRGINSDGSYPLRSFGSWRSS
APISPASSSGQLTDVSTATTPLRLNKIGKFLKTLQSDDESPSPFSDHQSFTTGIGIGARL
EQMQFGGGGDEELSAVEADHDVGSNTESSRGCEEPMDPGSWDSPTLVNGASSSSTSNNYN
FRQSPSLFSDPFKLEMTNSMHN
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgatttgtgcatcaaaaataacgatgctcgggcttttagtgatgtgcactcttggggga
gttttgggtaaagtagatatccgtcaaacgactgccaataaagccttcatggaaacaatg
cgtgcagatggctacgaagttgttcaccccttccaaattcgcgataaaaacgaacgaatc
ggaattgacacgcgaaattatttcctaaaagctcaagaacactactctcacgtgacaatt
gtgatacgatccaatcaactgggccgtctgaagctggtcttggaacgaaataatttcata
ttcctgaaccagacggctttccacaagttggatgcggatggcgagcgggttattcaaaat
cgtgtggaaaattgctactatcagggtactgtaggcggagaggagagctcatttgtggcg
ttgagctcgtgcaacgggctccgtggagttatctcattcgcgaacggaactacattcgga
atatggccactagatggcggggatcggaattcgagaaggcatccgcatattctatataaa
tccgaatggagtcaagaggcaaagtgtggaagttcgatggctcatgcggttggtcaacgg
cggatgaagaagcatgttcataagcatcggagccatcatcatgagcataataaaaaacga
gatgtttcgaaaaggacgaaatatgtggaagttgcgcttattgctgattatgaatttatg
aaagcccgcggacttcacgatctggatgccatctcatatatgctcgaatcattgaatatt
gcggattcgatgctctcccgtgacctcaacattcgcctttccgctgtatacgtcgaactt
tggactgatgttcaacgaatcgatctttgggaagatattgagcgaactttgagtggtgtc
gtcgattatgcttctgggcacatttatcatattcaaaaagacgcttcgatcctcttcaca
gccggctcatttgccaatcaagaagtgtcgaatgcggcgattcggagtatctgcaccgct
cgttcggcagtaattgtgaagggtgtcgaacaattcgcgacacactggaacggcgagctt
ctggctcaatcgattggccatttgctcgggttggagcatgatacgactgcgtgctcgtgt
gaaccatcgccagaatgtgtgatgcggcagcagccgggacgagttggcggtggtggtggt
tctccgttctcgtggcaattctcaaagtgttcggtggctagaatgcatggaatatggcag
gatgggaatattcagtgtttgctgaataagccatttcaagtctcggaacttcgcgagtgc
ggcaacggtgtcgtcgacggttccgaagaatgtgattgtggaagtcgtgagaattgccaa
gatccttgctgtgacccgctaacatgcacactccgtccacatgctcaatgtgccgcccat
cacaaatgctgtcatcgttgcgaacttcgaaaagctggcgacacgtgtcgatcttcaaaa
tctccgtgtgacgtagccgagcaatgtgacggaaaatcgggagactgcccgcctgatggt
catctaatcgacggtaccgtctgtggaactgatggacaatgctggagaggaaactgttcg
gatagtcaccaacaatgtcagaagctttggggacgagaagctcgagttgcggagccagtg
tgctttgagcagaataccaaaggagccgagtacgcgaattgtggacagcggcaagccgac
ggaacttatcacccatgtcaaattgaggatacccgatgtggaaccctacattgccacagt
ggaagtataactccgatcgactcgtcactcaaagcttttacctttcatttcacggaaaac
tcacaccaaatccagtgcaaatcgattgcgtcagccgcggttggtctgacatccgacggc
acaaattgtgcatccggaagagtttgtgtggctggaagttgcgtggagatgagctcggtg
agctctgcgaccgcttgtcctaccaataatcttgctcttttgtgctccggccacggccat
tgtacgactacagcgagatgtgtgtgttttaatgggtggtctggggtggcttgtgatatt
cgatcgaattcgtcgacttatcaaggaagtatgggatttggggaagaaggttcgggggga
tcttcacaaaaatcatccgagagaaaaaccatcatgatacctcacctgaacattggaacc
accctggagactgctacccttttcgcgattcttctcggattcggagtcttcctactccta
tgcctggtctgtctgatgctttgctatcggcgacgttcggtggtggagatcccgaagccc
agcgatgagaaggacgaggaatccccagatcggcagatcaaattcggcaatatgccatcg
tatcgggaagagaagcggaaacggaagagcaataagaagatctacggagcgctgaatcgg
atcacggaggctgacgagcgggattcgacgagtttgcggtcgagggatagtgctggagga
agtcagcagttggtggataggaggaatggggcgcccgtggttgttggggggatacgcgat
ccctacgccggagagcacatctacgcagagtcctcctcaaatcatctgactcgtcaattc
cgtggaatcaactccgatggctcatatcctctccgatctttcggttcatggcgatcttcg
gctccaatcagtccggcttcttcctcaggccaactgactgatgtgagcactgcgacaact
ccgctgaggcttaacaagattggaaaattcctgaaaacactgcaatccgacgatgaatcg
ccatctccgttctctgatcatcaaagtttcaccactggaattggaatcggagcccgcctg
gagcagatgcagtttggaggcggaggagacgaagagctatccgcagttgaagcggatcat
gatgtaggatccaatacggaatcatcaagaggatgtgaagaaccaatggatcctggaagt
tgggattccccgacgctggttaatggagcttcttcttcttcaacatcgaataattataat
ttccgacaaagtccctcacttttcagtgatccttttaagctagaaatgaccaatagtatg
cacaattaa

DBGET integrated database retrieval system