KEGG   Caenorhabditis elegans (nematode): CELE_Y37D8A.14Help
Entry
CELE_Y37D8A.14    CDS       T00019                                 

Gene name
cox-5A
Definition
(RefSeq) Cytochrome c oxidase subunit 5A, mitochondrial
  KO
K02264  cytochrome c oxidase subunit 5a
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00190  Oxidative phosphorylation
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CELE_Y37D8A.14 (cox-5A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX5A
Motif
Other DBs
NCBI-GeneID: 176707
NCBI-ProteinID: NP_499681
WormBase: WBGene00012553
Ensembl: WBGene00012553
UniProt: P55954
Position
III:join(12905496..12905622,12905760..12905825,12905933..12906111,12906253..12906405)
Genome map
AA seq 174 aa AA seqDB search
MASLTRAVTRLAIAGRQAVRTIATTTPVSGHGDDIMEKWPADKFDNHFINYLNRPEIDGW
EVRKALSELHDYDVIPDPKVVEAALRACRRVNDFALAVRFLEAIKIKCGAQKNRDTVYAY
IVKQVEPVLKELGIDTPEQLGYGEPEFFVPEPEYWWEKKWYKDYGYDKHPNIQI
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgttgacccgagctgtaacccgactggccatcgccggccgccaagccgtccgg
accatcgccaccaccaccccagtctccggacacggtgacgacatcatggagaagtggccc
gctgataagttcgacaatcacttcatcaactacctcaatcgcccagaaatcgacggatgg
gaggtcagaaaggctctctccgagttgcatgactacgacgttatcccagacccaaaggtc
gtcgaagctgcccttcgtgcgtgccgccgtgtcaacgactttgctttggctgttcgtttc
cttgaggctatcaagatcaagtgcggagcccagaagaaccgtgataccgtctacgcctac
attgttaagcaggtcgagccagtgctcaaggagctcggaatcgacacaccggaacaactc
ggatacggagagccagaattcttcgtgccagagccggaatattggtgggagaagaagtgg
tacaaggactacggatacgacaaacacccaaatatccaaatttaa

DBGET integrated database retrieval system