KEGG   Caenorhabditis elegans (nematode): CELE_Y37D8A.18
Entry
CELE_Y37D8A.18    CDS       T00019                                 

Gene name
mrps-10
Definition
(RefSeq) Probable 28S ribosomal protein S10, mitochondrial
  KO
K02946  small subunit ribosomal protein S10
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CELE_Y37D8A.18 (mrps-10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_Y37D8A.18 (mrps-10)
Ribosome [BR:cel03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    CELE_Y37D8A.18 (mrps-10)
  Bacteria
    CELE_Y37D8A.18 (mrps-10)
  Archaea
    CELE_Y37D8A.18 (mrps-10)
SSDB
Motif
Pfam: Ribosomal_S10 RdDM_RDM1
Other DBs
NCBI-GeneID: 189618
NCBI-ProteinID: NP_499685
WormBase: WBGene00012556
Ensembl: WBGene00012556
UniProt: Q9XWV5
Position
III:join(12926560..12926751,12926811..12926957,12927654..12927785)
AA seq 156 aa
MLKLASSLRTGLISRSIRTLAPTVNPAEQQQVQAVLPDKLYSSVEIEYRGHDKAVLKSYT
SFLQQVCQHLEIPQGRLEVLPYIRWVQPALRSKFVHKKYKLHYETRTHISKLEILNVTGS
TASTFLEYIQRNIPEGVGMRVGFTELQPLPLTIQKN
NT seq 471 nt   +upstreamnt  +downstreamnt
atgctaaaactcgcttcatccctcagaactggtcttataagccgaagcatccgaacatta
gcgccaacagtgaacccggccgagcaacagcaagttcaagcagttttacccgacaaactg
tacagctcagttgaaatcgagtatcgtgggcacgacaaggcggttttgaagtcatatacg
tcgtttttgcagcaagtctgccaacacctggagattcctcaaggtcgtctcgaagttctt
ccgtatattcgatgggttcagccggctctgcgctcgaaattcgtccataaaaaatataaa
ttgcattatgagacgagaacacacatttctaaacttgagatcctcaacgtgactggctcc
acagcttcaacattcctcgaatacatccaacgaaacatcccagaaggcgtcggaatgcgt
gtcggattcaccgaacttcaaccactaccgctgacaattcagaaaaattga

DBGET integrated database retrieval system