KEGG   Caenorhabditis elegans (nematode): CELE_Y37E11AR.1
Entry
CELE_Y37E11AR.1   CDS       T00019                                 

Gene name
best-20
Definition
(RefSeq) Bestrophin homolog
  KO
K22204  bestrophin, other
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_Y37E11AR.1 (best-20)
Transporters [BR:cel02000]
 Other transporters
  Pores ion channels [TC:1]
   CELE_Y37E11AR.1 (best-20)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 189623
NCBI-ProteinID: NP_500411
WormBase: WBGene00021368
Ensembl: WBGene00021368
UniProt: Q965X4
Position
IV:join(3756242..3756317,3756359..3756464,3756603..3756740,3757116..3757209,3757254..3757628,3757676..3757840,3758305..3758453,3758537..3758607,3758654..3758744,3758798..3758867,3758930..3759019,3759783..3759818)
AA seq 486 aa
MTVSYNSDVSSVSSTNFLRLLLRWKGSIWKSVSSELMMWCFSYFLIALLYHKVLFPNDYY
DSFNDVAFYCGKELHNYIPLTFMLAFFVSIIVERWRTTFTNMGWIESSALTVNAIIVSKC
DEARLIRRNIIRYLVLAQILTFRDISIRVRRRFPNIDSIKKAGFLTDNEEELLEGIDLAY
NKYWVPINWAISLSNQANSKGYVISAPGMVSLIQEIKTFRNGLATICNFDWCPIPIAYPQ
VVFFAVRIYFLFCLITRQYIRVPNKELEPVQMFIRPFITIIEFICIVGWMKVAEALLNPL
GEDDDDFESNFLIDKNIFTGMRIVDQFDEAPPLFEDTFSDPGAMPIYSEESQKNYQNGAL
VGSVSNVTLAQFDENITMVPVAPRLSIGDINAHDRSSIRRRFKSGSSQNCSRANSFREHP
KVLRQPSDGESNDAYELDYETVIKSVDDLVASSPTKPGKFFTSLTKVDENDEDIPATAKT
SVVSRV
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgacagtctcctataactccgacgtctcgtcggtatcctctactaattttctgcggctt
ttgctcagatggaaggggtcaatctggaaaagtgtgtcgtcggagctaatgatgtggtgt
ttcagttattttttaattgcactactctaccataaagtcttgtttccgaatgactattat
gactccttcaatgacgtggcattttactgtgggaaggagcttcacaactacattcctctt
acttttatgctagctttctttgtctcaatcattgtggagagatggaggaccacgttcacc
aatatgggatggattgagagctctgctctcacagtcaatgcaataattgtttcaaaatgc
gacgaggctcgtctgatcagacgaaatatcatccgatatctggtactggcccagatatta
acattccgcgacatttcgatcagagttcgtcgccgcttcccgaacatcgactcaatcaag
aaagccggattcctgactgacaacgaagaggaattgctggaaggcatcgatctggcctat
aacaagtactgggtacctatcaactgggcaatctcactgtcgaatcaggcaaactccaag
ggctatgtgataagtgctccagggatggtgagcttgattcaggagattaagaccttccgg
aatggcttggcaaccatctgtaactttgactggtgcccgattccaattgcctacccgcag
gtggtcttcttcgctgttcgaatctattttctcttctgcctgatcacgagacaatatatt
agagtgccgaacaaggaactcgagcccgtacagatgttcatcagaccgttcattacgata
attgaattcatctgtattgtcgggtggatgaaggtggcggaggcgttgctcaatccatta
ggcgaggacgatgatgattttgagagcaactttttgattgataagaacatttttaccggt
atgcggattgtggaccaatttgacgaagcaccgccgctcttcgaggacacattctccgat
ccgggagcaatgccaatttactcagaagaaagtcagaagaattatcagaatggagcacta
gtggggtcggtgtcgaatgtaacccttgcccaattcgacgagaacattaccatggtccca
gtggctccaagactctcaatcggggatatcaatgctcacgaccgttcgtcaattcgtcgc
cgcttcaagtcgggctcttcgcagaattgctcaagagcaaacagtttccgggagcacccc
aaagtactacgccaaccttcagatggagagagcaatgatgcatatgagctggattatgag
acagttattaaaagtgttgacgacctcgtagcttcatcgcccacaaaacctggaaagttt
ttcacaagcctcacgaaagtcgacgaaaatgatgaggatattccggccaccgcaaaaaca
tcagtcgtatcccgagtctga

DBGET integrated database retrieval system