KEGG   Caenorhabditis elegans (nematode): CELE_Y37E11AR.2
Entry
CELE_Y37E11AR.2   CDS       T00019                                 

Gene name
siah-1
Definition
(RefSeq) E3 ubiquitin-protein ligase siah-1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04120  Ubiquitin mediated proteolysis
cel04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CELE_Y37E11AR.2 (siah-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_Y37E11AR.2 (siah-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cel04121]
    CELE_Y37E11AR.2 (siah-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     CELE_Y37E11AR.2 (siah-1)
Ubiquitin system [BR:cel04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    CELE_Y37E11AR.2 (siah-1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 177138
NCBI-ProteinID: NP_500409
WormBase: WBGene00021369
UniProt: Q965X6
Position
IV:join(3744137..3744323,3745119..3745280,3745334..3745567,3745824..3746399,3746968..3747022,3747168..3747213)
AA seq 419 aa
MSNRNGGGGGGDYQDVIESLRRTQLIFEEDDNNSSDSAPQANHLSRHQTSNSLVEDMVNH
SNGNPPPVPPGITQQQCQIGLTPRMSASPPSAVSTISGTAVLGKTMARVQSNPPGSIPHN
TTTTAQGIQSVAPHIPIGGGGATDDSSAEILSVFECPVCLEYMLPPYMQCSSGHLVCSNC
RPKLQCCPTCRGPTPSVRNLGLEKIANTVRFPCKFSTSGCPLNFHHADKTEHEELCEFRP
YCCPCPGASCKWQGGLSDVMEHLKKIHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCF
DYNFMLVLEKQEKYDPAQPTQMFYAVVQLIGSKKEADNFVYRLELSASRRRMSWEATPRS
IHEGVVVAIQQSDCLAFDSNAAQLFAENGNLGINVTISRIDTPQRRHPNELENSDLEYD
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagtaatcggaacggtggtggaggaggaggagactatcaggacgtgatcgagtctctt
cgtcgtacacagctcatctttgaggaggacgataataatagtagcgattcggctccgcaa
gcgaatcatctatccagacatcagactagcaattctttagtcgaagatatggttaatcac
tcaaatggcaaccctccaccggtcccgccaggcatcacacaacagcaatgtcaaatcgga
ttgacacctcggatgtcggcatcgccaccgtctgcagtgtcaacaatctctggaaccgca
gtgcttggcaaaacgatggccagagttcagagtaatcccccgggaagtataccgcacaac
acaacgacgaccgcgcaaggaatccaaagcgtcgcaccacatattccaatcggcggcggt
ggagccaccgacgacagcagtgcagagatcttgtcggtgtttgagtgcccggtatgcctg
gagtacatgctgccaccatacatgcagtgctcatccggacatcttgtctgctcgaactgc
agaccaaagcttcagtgctgcccgacttgtcggggtccaactccttctgtccgcaacctg
ggcctcgagaagatcgccaacaccgtccgctttccatgcaaattctctacgtccggctgc
cccctgaacttccatcacgctgataagaccgagcacgaggagctctgcgaattccgaccc
tactgctgcccgtgccctggagctagctgcaagtggcagggaggcttgtcggatgtgatg
gagcatttgaagaagatccacaagagcatcacgacgcttcaaggcgaggatatcgtcttc
ctggccactgacatcaatcttcctggagcagttgactgggttatgatgcagagctgcttt
gactataattttatgttggtgctcgagaagcaggaaaagtacgatccagctcagccaact
cagatgttctacgcagtcgttcagctgattggctcgaagaaggaagctgataactttgtg
taccggcttgagctatcggcgagccgccggagaatgtcatgggaagccacaccgagaagc
atccacgagggggtggtagtggccattcaacagtcggattgcctagcgttcgattcaaat
gctgcacagctttttgcagaaaacggaaaccttggaatcaacgtcactattagccgaata
gatactccacagaggcgccacccaaatgagttggaaaattctgatctcgagtacgactag

DBGET integrated database retrieval system