KEGG   Caenorhabditis elegans (nematode): CELE_Y37E11AR.6
Entry
CELE_Y37E11AR.6   CDS       T00019                                 

Gene name
vab-2
Definition
(RefSeq) Ephrin RBD domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 177140
NCBI-ProteinID: NP_500412
WormBase: WBGene00006869
Ensembl: WBGene00006869
UniProt: G5EEE7
Position
IV:complement(join(3761432..3761511,3761582..3761968,3762502..3762767,3766714..3766820))
AA seq 279 aa
MHPPIKIQTILLFILTTVHCSAKRLPQIYWNSTNPLVERYAAIGDTLDIVCPFFDENSDE
LTEQSIIYRVTEEEYENCERRSKAKELGRCTQPYQEEKLKVAFRLMSPNPSGLDYRPGVT
YYFISTSTGSRKGLYNEQGGLCASHNLKMVIHITDRNGDIGPHHHRHHHKKTTTTTTTST
STSTPKTIPPVVEMDSSAEKLWEQFYEKVMPIDNTWPEITRGERVTLYQGNKKDEYEQVP
AEVVDFEIHEIGDVESLYSSSGRLRYVLLLPALLLLRIF
NT seq 840 nt   +upstreamnt  +downstreamnt
atgcacccacccatcaaaattcaaacaattttactgttcatcctcaccaccgtccattgt
tccgccaaacggttaccgcaaatctactggaactctacaaatcccctagtggaacgatat
gctgcaattggagacacccttgacatagtttgcccgtttttcgatgaaaactctgatgag
ctcactgagcaatcgattatctatagagtgactgaagaggaatatgagaactgtgaacgg
aggtcgaaggcaaaggaactgggaagatgtacacagccgtatcaggaggagaagcttaaa
gtggcgtttaggcttatgagcccgaatccgtcgggactggattatcggcctggagtcact
tattattttatttctacctcaaccggctcccgaaagggtctctacaacgagcaaggcggt
ctttgtgcgtcccacaatctgaaaatggtaatccacataactgaccgtaatggagacatc
ggaccacaccatcaccgccaccatcacaagaagaccactactaccaccacaacgagtact
tccacaagcaccccgaagaccattccgccggtcgtcgagatggacagctcggcggaaaag
ctgtgggagcagttttacgagaaagtgatgcctattgataacacatggccggagattaca
cgtggcgagcgggttacgttgtatcaggggaataagaaggatgaatacgagcaggttcca
gcggaagttgtcgattttgagattcatgagattggagatgtagaatctctgtactcatca
tctggacggctccgatatgtgctcctactgccggctctcctgctgctccggatcttctag

DBGET integrated database retrieval system