KEGG   Caenorhabditis elegans (nematode): CELE_Y38C1AA.11
Entry
CELE_Y38C1AA.11   CDS       T00019                                 

Gene name
prdx-6
Definition
(RefSeq) Thioredoxin domain-containing protein
  KO
K11188  peroxiredoxin 6 [EC:1.11.1.7 1.11.1.27 3.1.1.-]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00480  Glutathione metabolism
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CELE_Y38C1AA.11 (prdx-6)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     CELE_Y38C1AA.11 (prdx-6)
    1.11.1.27  glutathione-dependent peroxiredoxin
     CELE_Y38C1AA.11 (prdx-6)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     CELE_Y38C1AA.11 (prdx-6)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C AhpC-TSA_2 SCO1-SenC ISPD_C
Other DBs
NCBI-GeneID: 176837
NCBI-ProteinID: NP_741287
WormBase: WBGene00021401
Ensembl: WBGene00021401
UniProt: Q8MXT1
Position
IV:join(218567..218652,219462..219842,220541..220769)
AA seq 231 aa
MKLGDTVPNFTFETDLRKNQTLHNYIGEQWLMLFSHPADFTPVCTTELAELVKLAPEFRK
RHVQILAISIDSSETHRDWAKDINSVAQLSNCGSHLPFEIIADTDRSICTELGMIDPDEM
NSEGICLSARAVMLFGPDKKLKSKILYPATFGRNFVEILRMVDGVQLGTKAPVATPANWI
AGDNVIAQPSLSQERVIQELCGGDPDKCKTVPLPSGKSYLRVIEGDAYLQN
NT seq 696 nt   +upstreamnt  +downstreamnt
atgaagctcggagacaccgttccaaattttacattcgaaacggatcttcgcaaaaatcaa
actttgcacaactacattggagaacaatggctgatgctgttcagtcacccggccgacttt
acgcccgtctgcactacagaactcgccgagctcgtcaaattggctcccgaattccgcaaa
cgccatgttcagatccttgcgatcagtatcgattcatcagaaactcatcgtgattgggca
aaagacattaattcggtggcacaattgagcaattgcggaagccatttgccatttgaaatc
atcgccgacacggatcgatcgatttgtacagaactcggaatgattgatccggatgagatg
aattcggagggaatctgtctttcggctcgtgctgtgatgctttttggacctgataagaag
ctcaaatcgaagattctctatccggctacgttcggcagaaattttgtcgaaattctccgc
atggtcgacggtgttcaactcggcacaaaggctccagtggcaactccggctaactggatt
gccggtgacaatgtcatcgctcaaccatctctgagtcaagagagagttattcaggagctt
tgtggtggagatccagacaaatgcaagacggttccgttgccgagtggaaagagttatcta
cgtgtcatcgagggagacgcttacttgcagaattga

DBGET integrated database retrieval system