KEGG   Caenorhabditis elegans (nematode): CELE_Y38F1A.10
Entry
CELE_Y38F1A.10    CDS       T00019                                 

Symbol
max-2
Name
(RefSeq) Serine/threonine-protein kinase max-2
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_Y38F1A.10 (max-2)
   04012 ErbB signaling pathway
    CELE_Y38F1A.10 (max-2)
   04392 Hippo signaling pathway - multiple species
    CELE_Y38F1A.10 (max-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_Y38F1A.10 (max-2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_Y38F1A.10 (max-2)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_Y38F1A.10 (max-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_Y38F1A.10 (max-2)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: STE group
  STE20 family
   CELE_Y38F1A.10 (max-2)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CELE_Y38F1A.10 (max-2)
 Endocytosis
  Macropinocytosis
   Kinases
    CELE_Y38F1A.10 (max-2)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     CELE_Y38F1A.10 (max-2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal ABC1 APH Kinase-like DSHCT
Other DBs
NCBI-GeneID: 3565400
NCBI-ProteinID: NP_001076635
WormBase: WBGene00003144
UniProt: G5EGQ3
Position
II:complement(join(13015367..13015463,13016104..13016216,13017269..13017419,13017469..13017582,13018448..13018980,13023652..13023857,13023908..13024069,13025039..13025232,13025451..13025528,13025578..13025702,13025755..13025778))
AA seq 598 aa
MSTSKSSKVRIRNFIGRIFSPSDKDKDRDDEMKPSSSAMDISQPYNTVHRVHVGYDGQKF
SGLPQPWMDILLRDISLADQKKDPNAVVTALKFYAQSMKENEKTKFMTTNSVFTNSDDDD
VDVQLTGQVTEHLRNLQCSNGSATSPSTSVSASSSSARPLTNGNNHLSTASSTDTSLSLS
ERNNVPSPAPVPYSESAPQLKTFTGETPKLHPRSPFPPQPPVLPQRSKTASAVATTTTNP
TTSNGAPPPVPGSKGPPVPPKPSKENSNDKSVGDKNGNTTTNKTTVEPPPPEEPPVRVRA
SHREKLSDSEVLNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMA
FKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTEL
DEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRD
TVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKP
EIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAKPLSSLIPYIRAVREK
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgtcaacttcaaaaagttccaaggtgcgaatacggaatttcatcgggcgaatcttctct
cccagcgataaagacaaggatcgagacgatgagatgaagccatcctcgtccgcaatggat
attagtcagccatataacacagtgcatcgagtccacgttggatacgacggccagaagttc
agcggactgccgcaaccatggatggatattcttctccgagacattagtcttgccgatcag
aagaaggatccgaacgcggtggtgactgcgttgaagttctacgcacaatcaatgaaggag
aacgagaagacgaaattcatgacgacgaatagtgttttcacgaatagcgatgacgatgat
gtggacgttcagttgaccggacaagtcacggaacatttgaggaatttgcagtgtagtaat
ggttccgcaacttccccatctacatcagtgtcagcttcatcttcttctgctcgtccactg
acaaatggaaataatcatctttccacggcgtcgtctaccgacacatctctctcattatcg
gaaaggaataacgttccgtctccagctccagttccatatagtgaaagtgctccacaactg
aaaacattcaccggagagactccaaaactgcatccacgatctccgttcccgcctcaaccg
ccagttcttccgcaacgaagcaaaaccgcatcggcagtggcgacgacgacgacgaatccg
acgacttcgaatggagcaccaccaccagttcctggatcgaaaggacccccggtgccaccg
aaaccatcgaaggaaaattcgaatgacaaatcagttggagacaagaatgggaacaccacc
acaaacaaaacgaccgtcgaaccacctccaccagaagagccacctgttcgtgttcgagca
tctcatcgtgaaaagctttctgattccgaagtgctcaatcaactccgcgagattgttaat
ccaagtaatccacttggaaagtacgagatgaagaagcaaatcggtgttggagcatccgga
actgtattcgttgctaatgtggccggcagcactgatgtggtggctgtgaagagaatggct
ttcaagactcagccgaagaaggagatgttgctcaccgagattaaggttatgaagcagtat
cgacacccgaacctcgtcaactacattgaatcgtatctggttgatgctgatgatctttgg
gtagtgatggattatctggaaggtggaaacttgacagatgtcgttgtgaagactgagttg
gacgaaggacaaattgcagcagttttgcaagaatgtcttaaagcgcttcacttccttcat
agacactccatagtgcaccgagatatcaagagtgacaacgtgctgctcggcatgaacgga
gaggttaagctcaccgatatgggattctgtgctcagattcagccgggatcgaaaagagat
actgtcgtcggaactccatattggatgtcgccggagatattgaacaagaagcagtacaac
tataaggttgacatttggtcgctgggaattatggctctagagatgattgatggagagcca
ccatatttgagagaaacacctttgaaggctatctacttgattgctcaaaacgggaagcca
gagatcaagcaacgcgacagactgtcttcagagttcaacaatttccttgacaagtgtctt
gttgttgatccggatcagagagccgatacaacggagctcttggcacatccattcctgaaa
aaggcgaagccactctcaagcctgattccatacatcagagccgtccgagaaaagtag

DBGET integrated database retrieval system