KEGG   Caenorhabditis elegans (nematode): CELE_Y39A1A.23
Entry
CELE_Y39A1A.23    CDS       T00019                                 

Gene name
hpr-9
Definition
(RefSeq) Cell cycle checkpoint protein hpr-9
  KO
K10994  cell cycle checkpoint control protein RAD9A [EC:3.1.11.2]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cel03400]
    CELE_Y39A1A.23 (hpr-9)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     CELE_Y39A1A.23 (hpr-9)
DNA repair and recombination proteins [BR:cel03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    CELE_Y39A1A.23 (hpr-9)
SSDB
Motif
Pfam: Rad9 FAM176 Ima1_N
Other DBs
NCBI-GeneID: 176483
NCBI-ProteinID: NP_499342
WormBase: WBGene00001997
Ensembl: WBGene00001997
UniProt: Q95Q27
Position
III:join(10621557..10621668,10621718..10621788,10621842..10621967,10622016..10622130,10622179..10622284,10623218..10623623,10624420..10624475,10624529..10624711,10624872..10624943,10625379..10625586,10626048..10626147,10626224..10626234)
AA seq 521 aa
MQAIHENYTDNPSSSITRERQHEDMKGAQFVVQSNLKIMSRSIAALSKISEDVLIEVSEG
GLFFKTVNRSKFCVFRFAPEFFNACDVSMINKKAVNICRLSMKSAQRIFKGVAFGEKNFV
GCEFRIDPKAERMMVKLQMNYDIERTIHAKLREMGSMLHKPTYNRSGCRNITVVFASTLL
PIFVQMKGDIEVTMKVTDDGLTIRNFHSLDGVTMFNMGVEKGAKKVKTETTITCEKLTRH
KIQIPVEFSFSIKEFLSIVTFADQLGSEVCMYYDLPGKPLIVSIEAHPNFDIELALATMG
SDDEIDLDGGILKETMAQHEEEEDKSTAHSSSSRRKSKAIDTSSSGTQKSKKCSESLSQE
ETTRSQSLPSRNRFVPEIPVAEQSWRDREVTVYEQREPSPDLQIVEEVMEIDNQPIVTRT
IKEEHSVEQAMQDVSIETIPVETPEENIIPVEVEMLEEPEQEDQEIFKIPQPKRRKTAED
DRNRKIRRILMGTETTSKMRMSQQFDKRLGPLVSDTQYESR
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgcaagccattcatgaaaattatacagataatccatcgtcatcaataacaagggaaagg
cagcatgaagatatgaaaggcgcccaatttgtggtccaatccaatcttaaaattatgtca
agatccatcgcagcgctgagcaaaatctctgaagacgtgttaattgaggtttccgaaggc
gggctcttcttcaaaacagtgaaccgttcaaagttctgcgtgttccgctttgcaccagaa
tttttcaacgcttgcgatgtatcaatgattaacaaaaaagcagtgaatatttgcagatta
tcgatgaaatcagctcagcgtattttcaagggcgtcgcgttcggggagaagaactttgtt
ggatgtgaatttcgaatcgatccgaaggctgaacggatgatggtgaagcttcagatgaat
tatgatattgagcgaacaattcacgcaaagcttcgagaaatgggatcaatgcttcataag
ccaacatataatcgttctggatgtagaaatatcactgtcgtttttgcatcaacgcttctc
ccaatcttcgttcaaatgaaaggtgacattgaagtaacaatgaaagtaacagatgatggt
ctaacaattcgaaatttccattcattggacggtgttacaatgttcaacatgggagttgaa
aaaggcgccaaaaaagtaaaaactgagacaacaatcacttgcgagaagctcacccggcac
aaaattcagattcccgtcgaattttctttttcgattaaggaatttttatcgattgtcaca
tttgccgatcagttgggatcagaagtttgcatgtattatgatctaccaggaaaaccgttg
attgtatcaattgaagctcatcctaattttgatattgagctggcgttggctacgatggga
agtgacgatgaaattgacttagatggaggcattttgaaagaaactatggcgcagcatgaa
gaggaggaagataaatctactgctcattcatcaagctcccgccgaaaatcaaaagcaatt
gacacttcaagttcaggaactcaaaaatcaaaaaaatgctccgaatcactgtcacaagaa
gaaactactcgctcgcaatcccttcccagcagaaaccgcttcgttccagaaattccagtc
gccgagcaatcttggagagatcgtgaagtgactgtgtatgaacaacgagaaccgtctcct
gatctacaaattgttgaagaagttatggaaatcgataatcaaccgatagtcaccagaaca
ataaaagaagagcattccgtagaacaagcaatgcaagatgtcagtattgaaacaattcct
gtagagacccccgaagaaaatataattcccgtagaagtagaaatgctagaagaacctgaa
caagaagatcaagaaatattcaaaattccccagccgaaaagaagaaaaaccgccgaagat
gacagaaatagaaagattcgtcgaattctaatgggaactgaaacgacgtctaaaatgaga
atgagccaacaattcgacaagcggcttggtccattggtttcggatactcaatatgaatcg
agatga

DBGET integrated database retrieval system