KEGG   Caenorhabditis elegans (nematode): CELE_Y41D4A.6
Entry
CELE_Y41D4A.6     CDS       T00019                                 

Symbol
Y41D4A.6
Name
(RefSeq) Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00970  Aminoacyl-tRNA biosynthesis
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_Y41D4A.6 (Y41D4A.6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_Y41D4A.6 (Y41D4A.6)
Enzymes [BR:cel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CELE_Y41D4A.6 (Y41D4A.6)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CELE_Y41D4A.6 (Y41D4A.6)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CELE_Y41D4A.6 (Y41D4A.6)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 176982
NCBI-ProteinID: NP_500129
WormBase: WBGene00021508
Ensembl: WBGene00021508
UniProt: Q95Y25
Position
IV:complement(join(1741096..1741432,1741486..1741623,1743947..1744399,1745025..1745300,1745349..1745503))
AA seq 452 aa
MHRIESSIEKAVKYRSHGIFITETFELARQQAKNALKNGLNPFPIAVKDCFLTNGTSTTC
ASQMLEKYTPPVNATIVERIVARGGCIIGKTNLDEFCMGTSSALGHFGPVKSDLTEPGGT
EDWTIPGGSSGGSAVAVQTGIADFALGSDTGGSTRNPAAFNGIFGFKPTYGVLSRNGLIP
LVNSLDAPSIFAKTAQKCWELLELSKGIDKNDSTSVELPEKAGISSLEGLKIGIPVEYHN
ECLTEDAWRHWNRVTGLLKSRGAAEIHVLNLPTTRFSLACYSVIAAADVASNMARYDSVA
YGHRSSSDSSTYEMYASSRSEALNTIVRRRIFAGNYFLMKQYRQKYFERALKVRRIIHDE
LRQAFREVDLIVTPTASGTAPKYSELRDTLFSKEDNDDYFTQAANLAGIPSISVPVGVAE
DGLPIGVQLMADKLQDRAVCDVAHILDGLIRK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcacagaatcgaaagttctatcgaaaaagctgtaaaataccgttcccatggcattttt
atcactgaaacctttgaattggcgcgtcaacaggcgaaaaatgcgctgaaaaacggccta
aatccctttccaatcgccgtaaaggactgctttttaacaaatggcacaagcacgacatgc
gcctcacaaatgctggaaaagtacacaccgcccgtgaatgcgacaatcgtggagagaatc
gtcgcgcgcggtggatgtattatcggaaagacgaatctcgacgaattctgtatgggaact
tcgtcggctctcggacattttggaccggtgaagagtgatttgacggagcctggtggcact
gaggattggactattccgggaggaagctctgggggctctgcagttgccgttcagactgga
atcgctgatttcgctctcggctcggataccggcggttcaaccagaaatcctgctgctttt
aacggaattttcggtttcaagccaacttatggagttttatcacgcaatggcttgattcct
ctggtgaattcactggatgctccgtcgattttcgcgaaaaccgctcaaaaatgttgggaa
ttgctggaattatcgaagggcattgataaaaacgactcaacaagtgtagaacttccagaa
aaagctggaattagctctctggaagggctgaaaatcggaattcctgtggaatatcacaac
gaatgcctgacagaagacgcgtggaggcactggaatcgggttacagggcttttgaagagc
cggggagctgctgaaattcatgtgctgaaccttccgacaactagattctcgctggcttgc
tactcggtgatcgccgccgcagatgtcgcctcgaatatggcgagatacgacagtgttgcc
tatggccatcgttcttcaagcgactcttcaacatacgaaatgtatgcttcttcccggtca
gaagccctgaatacaattgttcgacggcggattttcgctggaaattatttcctgatgaag
caatatcgccaaaagtactttgaaagggcgctaaaagtgcggagaatcatccacgacgag
ttgcgccaggctttccgggaagtcgatttgattgtcacgccgacagcgtctggaacagcg
ccgaaatattctgaattacgggatacgttgttctcgaaggaggataatgatgattatttc
actcaggccgccaatttggccgggatcccatcgatttctgttccagttggagttgcggaa
gatggactgccgattggtgttcagttgatggctgataagcttcaggatagagctgtctgt
gatgtggcacatattttggatggtttaattcggaaatag

DBGET integrated database retrieval system