KEGG   Caenorhabditis elegans (nematode): CELE_Y41E3.4
Entry
CELE_Y41E3.4      CDS       T00019                                 

Symbol
qars-1
Name
(RefSeq) Probable glutamine--tRNA ligase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00970  Aminoacyl-tRNA biosynthesis
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_Y41E3.4 (qars-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_Y41E3.4 (qars-1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_Y41E3.4 (qars-1)
Enzymes [BR:cel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     CELE_Y41E3.4 (qars-1)
Amino acid related enzymes [BR:cel01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CELE_Y41E3.4 (qars-1)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CELE_Y41E3.4 (qars-1)
 Prokaryotic type
   Other AARSs
    CELE_Y41E3.4 (qars-1)
SSDB
Motif
Pfam: tRNA-synt_1c tRNA_synt_1c_R1 tRNA-synt_1c_C tRNA_synt_1c_R2
Other DBs
NCBI-GeneID: 178415
NCBI-ProteinID: NP_001255843
WormBase: WBGene00001336
Ensembl: WBGene00001336
UniProt: O62431
Position
IV:complement(join(15008630..15008744,15008804..15009331,15010374..15011020,15011713..15012198,15012521..15012856,15012928..15013176))
AA seq 786 aa
MATKEELLSLGLSDSKVAETLKNVKLTETIGSIVKLASESGEISKQKGTLLYQLATKLKP
QVAAHTPLVVKYIMNDGIKTEPQLSAAIEYLLSHTVKGIQVPDFEKSCGVGVVVTIDDIE
AAVTKVIGQHREKIVAERYSFPAGKLLGELRALLPWADGAITKKEVDLRFLELLGPKTAE
DLAPKKKEKKPEGPKPSKDAAAAATAPGTKNQKEASPEEFADGAETMDELLRTRAHFHKV
GENFKQDGYVTTPKTAELLKAHVAAVGGKVVTRFPPEPNGVLHIGHAKAININFGYAKAM
GGVCNLRFDDTNPEKEEEKFFSAIEDIVHWLGYDPARVTHSSDNFQQLYLWAVKLIQKGL
AFVCHQKVEEMRGFEVQLSPWRERPIEENIQLFEDMKNGKFDEGEATLRLKLTLEEGKVD
PVAYRIKYVPHHRTGNQWCIYPTYDYTHCLCDSIENITHSLCTKEFQSRRSSYYWLCNAL
DIYCPVQWEYGRLNVNYTVVSKRKILKLITTKTVNDWDDPRLFTLTALRRRGIPSEAINR
FVAKLGLTMSQMVIDPHVLDATVRDYLNIHAPRTMAVLEGLKLTIENFSELNLPSSVDVP
DFPSDPTDPRKHSVSVDREIFIEKSDYKPDDSDKSFRRLTPKQAVGLKHIGLVLRFVKEV
KDAEGHVTEVVVKAEKLSEKDKPKAFIHWVAKPVSCEVRLYDRLFKSKNPEDAQLVPGGF
LSDINPDSLTVVYNALIDQSIAKSKVYDRFQFERIGFFCVDRDSTSSTLVFNRTVMLKDG
GASGKN
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcaacaaaggaggagcttctctctttgggcctctctgattcaaaagtagctgaaacg
ctgaaaaatgtgaagctcaccgaaacgatcggttcaattgtgaagcttgcgagcgagtct
ggcgagatttccaagcaaaaaggaacacttttgtaccagttggcgacaaagttgaagcca
caagtcgctgctcacactccactagttgtcaagtatattatgaatgacgggattaagaca
gagccacagctctccgcagcgatcgagtatcttctctcgcacaccgttaaaggtatccaa
gtgcctgatttcgagaaatcatgcggagtcggcgttgttgtcacaatcgacgacatcgaa
gcggccgttaccaaggtgattggccaacaccgcgagaaaatcgtcgccgagcggtactcg
ttcccggccggaaagttgctcggcgagctacgagctctgcttccatgggctgatggtgcg
attacgaagaaggaggtggatttgagattcttggagctgctcggaccgaagactgcggag
gatttggctccgaagaagaaggagaagaagccggaaggcccgaaaccttccaaagacgct
gccgctgccgccaccgctccaggaaccaaaaatcaaaaggaagctagccccgaagaattc
gctgatggcgccgaaaccatggacgagctgctccgcacccgtgcgcatttccacaaagtc
ggagaaaacttcaagcaagacggctacgtgaccactccaaaaaccgcagagcttctcaag
gctcacgtggcggctgtcggagggaaggtggtgacccgattcccgcctgaaccaaatggt
gttcttcatattggacacgcgaaggcgattaacatcaattttggatatgctaaagctatg
ggtggtgtgtgtaatttgagatttgacgatacaaatccggaaaaggaagaggaaaagttc
ttctctgcaattgaggatattgttcattggcttggatatgatccggctagagttactcac
tcttcggataattttcagcagctttatctttgggctgttaagcttattcagaaaggactc
gctttcgtatgccatcaaaaagtcgaagaaatgcgcggtttcgaagttcaactgagcccg
tggcgtgagcgaccaatcgaagagaacatccaactcttcgaagacatgaaaaatggaaaa
ttcgacgaaggagaagccacactccggctcaagttgacactggaagaaggaaaagtcgat
ccagtcgcctaccgtatcaaatatgttccacatcatcgaactggaaatcaatggtgcatc
tacccgacctacgattatacccattgcctttgtgattcaattgaaaatatcactcattct
ctgtgcaccaaagagttccagtcgagaagaagctcatattactggctctgtaatgctcta
gatatctattgtcctgttcaatgggagtacggtagactaaatgtcaactatactgtggtc
tcgaagcgaaagattctcaaacttatcaccacaaaaaccgtcaacgattgggatgatcca
cggttgttcacactgacagcactccgacggcgtggtatcccatctgaggcgattaatcga
ttcgttgcgaagctcggattgacaatgtcacagatggttattgatccacacgttcttgac
gcaactgttagggattatttgaatattcacgcgccaagaacaatggccgtgctcgaggga
ttgaagctgacaatcgaaaacttttccgaactcaatctcccatcatccgtcgacgttcca
gacttcccatctgatccgactgatccacgaaagcactcggtatccgtcgatcgggagatt
ttcattgaaaagtccgactataagccggatgattcggacaaatccttcagaaggctgacg
ccgaaacaagccgtcggcctgaaacacattggattggtgctccgattcgtgaaagaagtc
aaagatgccgagggtcacgtcacagaagttgtggtgaaggctgagaagttgtcggagaag
gataagccgaaagcatttattcattgggttgcaaagcctgtctcgtgtgaagttcggctc
tatgatagactattcaagagtaagaatccagaggatgctcaactagttccaggtggattc
ctgtcggatatcaatccagattcattgacagttgtctacaatgctctaattgatcagtct
attgcaaaatcaaaggtttatgatagattccaattcgaacgcatcggattcttctgtgtc
gatcgtgattcgacgtcttcaacgttggtcttcaaccgaactgtcatgctgaaagacgga
ggagcttctggaaagaattga

DBGET integrated database retrieval system