KEGG   Caenorhabditis elegans (nematode): CELE_Y42H9B.1
Entry
CELE_Y42H9B.1     CDS       T00019                                 

Gene name
col-115
Definition
(RefSeq) COLlagen
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 189843
NCBI-ProteinID: NP_501338
WormBase: WBGene00000689
Ensembl: WBGene00000689
UniProt: Q9N3X9
Position
IV:join(7988688..7988831,7989334..7989567,7990012..7990147,7990257..7990770,7991160..7991313)
AA seq 393 aa
MKGNEKDLELLARRMRQLAVFSSSVAVFVAVLAVFALPILITSTLQAVTSVDDSLGRCTA
DAFKMYKAIDEIEIQLIQSFNKTTSQRSKRGGGYVSSSSYGGQYSGQQYDSTGNAATNGQ
YRFFPEVIEAIRARRPTLYSLQQDYNSGGYAGQGGCGASQQGYASRPVFVGPQTGSILRD
GQSGFNGGGGCIPRYGPPGAPGASGQSGRDGQDGQPGTDGQQGRDGIADIDREPCQVCAP
APQGYPGPPGPKGRTGEQGPPGLDGETIDGEDGSPGLPGPPGPPGPPGLHGSPGSYGESK
EEEIAGPPGPPGVRGIQGGVGSRGAEGNPGPKGPPGLQGDIGSHGIAGRPGLQGRPGNPG
APGSPASCDHCAPPVLEPGYQVDVKKTIKRASP
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgaagggtaatgagaaagatctagaactgttagcgcgacgaatgcgtcaattggccgtt
ttctcgtcatcagttgctgtatttgttgcagttcttgccgtctttgctctaccaattctt
atcacatctacacttcaagcagtgacatccgtagacgatagtttgggaagatgtactgcc
gacgcatttaaaatgtacaaagcaattgatgaaatcgagattcaacttattcaatcgttt
aataaaacgacttctcaaagatcaaaacgtggtggaggatatgtgtcatcatcttcttat
ggtggacaatattctggtcaacagtatgattctactggaaatgctgcaactaatggacaa
tatcggtttttcccagaggttattgaagcaatccgagccagaagaccaacattatattca
ctacaacaagactataactctggcggatatgctggacaaggagggtgtggagcatcacaa
caaggatatgcttctagaccagtttttgttggaccacaaactggttcaattctccgagat
ggtcaatctggttttaatggtggaggtggttgtattccacgttatggtccacctggtgct
ccaggagcttcaggacaatcaggacgtgatggacaagatggacaaccaggaacagatggt
caacaaggtagagacgggattgctgatattgatcgtgaaccatgtcaagtatgtgctcca
gcaccacaaggttatccaggaccacctggaccaaaggggcgtacaggagaacagggacca
ccgggattagacggagaaactattgatggagaagatggatcaccaggtcttccaggacca
ccgggaccaccaggacctccaggattacatggatcaccaggatcatatggagaatcgaaa
gaagaagaaattgcaggaccaccaggcccaccaggtgtcagagggattcagggaggagtt
ggatcaagaggagctgaaggtaatccaggaccaaagggaccaccaggactacaaggagac
attggatcacatggaatagcaggccgacctggtcttcaaggtcgtccaggtaaccctggg
gctcctggctccccagcttcatgtgatcattgtgctccaccagttctcgagcccggctac
caagtggatgttaaaaagacaattaaacgcgcttctccatga

DBGET integrated database retrieval system