KEGG   Caenorhabditis elegans (nematode): CELE_Y43F8A.1
Entry
CELE_Y43F8A.1     CDS       T00019                                 

Gene name
Y43F8A.1
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Other DBs
NCBI-GeneID: 189865
NCBI-ProteinID: NP_507769
WormBase: WBGene00012808
Ensembl: WBGene00012808
UniProt: Q9XWL6
Position
V:join(19370602..19370690,19371232..19371331)
AA seq 62 aa
MKIAVFLVVFALFIGVFVQGQRVFDMMDEKASNPGGRSAIYQRKSYLQPFYNAPTQLFWR
RY
NT seq 189 nt   +upstreamnt  +downstreamnt
atgaaaattgccgttttcctggtggtttttgcactttttattggcgtttttgtgcaagga
caacgagtttttgatatgatggatgagaaagcttccaacccaggcggtcgttcggcgatc
taccagcgaaaatcgtatctccaaccattctacaatgctccaactcaacttttctggcgg
agatattaa

DBGET integrated database retrieval system