KEGG   Caenorhabditis elegans (nematode): CELE_Y43F8B.5Help
Entry
CELE_Y43F8B.5     CDS       T00019                                 

Gene name
scl-21
Definition
(RefSeq) SCP-Like extracellular protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-GeneID: 189870
NCBI-ProteinID: NP_507793
WormBase: WBGene00012816
Ensembl: WBGene00012816
UniProt: Q9XWX3
Position
V:complement(join(19494762..19494861,19494910..19495223,19495505..19495687))
Genome map
AA seq 198 aa AA seqDB search
MKFLIIFCLAAVSVHAQFSASAQKEIVTYINDLRSLVASRRFHLDSRDVETLPPASDMLK
MTWNSTLAVAAQKLAKTCFIAVESSSPGIADKRIVAANVVTVAKNALGHWKHSLNKEWNL
KSYNSNYIGIQLIWAKSSSVGCGFSPCEIDSQGRRWYKVVCSFEKKGGITREPVYKKGKA
CEACPAGTKCASGSVLCS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcttatcattttctgtctagcggcggtgtctgtccatgcccaatttagtgcg
tctgctcaaaaggaaatagtcacctacattaacgatttacgctccctcgtggcaagtaga
agatttcatctcgattctcgagatgttgaaactttgccgccagcgtcagatatgcttaaa
atgacctggaactctacgctggcagttgcagcgcaaaaacttgcaaaaacttgctttatt
gctgttgaatcgtcgtcgcctggaatagccgacaaacgtattgtagcagcaaacgtggtt
acggttgccaaaaatgcactgggtcattggaaacactcactaaacaaagaatggaacttg
aaaagttataatagtaattacattggaattcaactaatctgggccaaatcttcatcagtt
ggctgtgggtttagtccgtgtgaaatagactcccaggggagacgttggtacaaagtagtg
tgttcgtttgagaaaaaaggaggtattactcgtgagcccgtctacaaaaagggaaaagcc
tgcgaggcgtgtccagctggcactaaatgtgcttctggatcggttttgtgttcttaa

DBGET integrated database retrieval system