KEGG   Caenorhabditis elegans (nematode): CELE_Y46H3A.2Help
Entry
CELE_Y46H3A.2     CDS       T00019                                 

Gene name
hsp-16.41
Definition
(RefSeq) Heat shock protein Hsp-16.41
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP20 ArsA_HSP20
Motif
Other DBs
NCBI-GeneID: 178660
NCBI-ProteinID: NP_872116
WormBase: WBGene00002018
UniProt: P06581
Position
V:join(1805271..1805408,1805467..1805760)
Genome map
AA seq 143 aa AA seqDB search
MLMLRSPYSDSNALDHFLDELTGSVQFPYWRNADHNSFNFSDNIGEIVNDESKFSVQLDV
SHFKPENLKIKLDGRELKIEGIQETKSEHGYLKRSFSKMILLPEDADLPSVKSAISNEGK
LQIEAPKKTNSSRSIPINFVAKH
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgctccgttctccatattctgattcaaatgctcttgatcatttcttggacgaa
ctcactggatctgttcaatttccgtattggagaaatgctgatcacaactcattcaatttt
tccgataatattggggagattgtaaatgatgaatccaagttttcggttcaactcgatgtc
tctcatttcaaaccagaaaatcttaagattaaattagatggaagagagctcaaaattgaa
gggattcaagaaacaaaatcggaacatggatacttgaaacgctcattttcaaaaatgatt
cttctaccagaagatgctgatttaccttctgtcaaatctgccatttcgaatgaaggaaaa
ctccaaattgaggctccaaagaagacaaactcatcacgttctattccgatcaattttgtt
gcaaaacattaa

DBGET integrated database retrieval system