KEGG   Caenorhabditis elegans (nematode): CELE_Y46H3D.4Help
Entry
CELE_Y46H3D.4     CDS       T00019                                 

Gene name
irld-17
Definition
(RefSeq) Insulin/EGF-Receptor L Domain protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Recep_L_domain
Motif
Other DBs
NCBI-GeneID: 189969
NCBI-ProteinID: NP_503463
WormBase: WBGene00021609
Ensembl: WBGene00021609
UniProt: Q966B5
Position
V:join(1632017..1632107,1633161..1633400,1633444..1633626,1634228..1634526,1634569..1634935,1635501..1635568,1635616..1635748,1635795..1635883)
Genome map
AA seq 489 aa AA seqDB search
MLLIFLIFISIAQCAQELSDIEKIEQAYDCDPKCWFREAEVNSSTITQWPVNCTEVCGIM
NFNAGSDLPVFELQTYFKNLRVLKGVLQFSYTKYASIEFLLSLEEIHCDAVTLGVSFSFN
SNLEVLNFNNLTNITCDFYAYNNTILDGTEFCDRYADLALMFVYNNFKNCKGCVSDQLHS
TELDKFRGCTAIVNTMFFMFFNVYTTQPPIDLSPLSDIQNISGCLNFYSTDLHDFSFFEK
LENIKSNKYANVDINIFESYNLTRFRMPALKTIETTRDNFIINVEKVHDDFCFTPSEMLF
FLKNEVIFSKIEAKICQNVTEEDGEDDCIFDGMSKLDNNCSDVLGKITIGSGDEAYVEKL
RNVKNIYGGIRIENTNLTNLEFLGSLEYVASLNDSAVPFQISSNKLLQNASLPNLKRVFS
TSRYQIGFQENGNDFLNSTACLFLMNQLFLTNVVFDGNECEAIDRTNQNNGANWIFRLNF
FILLLWVSL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcatatttctaatttttatatcgattgctcaatgtgcacaagaattgagtgat
attgagaaaattgagcaagcttatgattgtgatcccaaatgctggttccgtgaagccgaa
gtcaactcatctacaataacacagtggcctgtgaactgtaccgaagtatgtggaattatg
aatttcaatgccggatctgacctccccgtgttcgaactacagacttattttaaaaatttg
agagttttgaaaggagttcttcaattttcatatacaaaatacgcgagtatcgagtttctt
ttgagcttagaggaaattcattgcgatgcagtaacgctcggtgtgtcattctcattcaat
tcaaatcttgaagtgctaaactttaataacctgacaaatataacatgcgatttttatgct
tataacaacacaatcttagatggaacggagttttgtgatcgatatgcagaccttgctcta
atgtttgtatacaacaattttaaaaattgcaaaggatgcgtttctgatcaactacactca
actgaacttgacaaattccgagggtgtacggcaatagtgaatacaatgtttttcatgttt
ttcaacgtttataccacccaaccacctattgatttatcccctcttagtgatattcaaaac
atcagtggttgtctcaatttctactcgaccgatttgcatgacttttcttttttcgaaaag
ttggaaaatatcaagtcaaataaatatgcaaatgtggacattaatattttcgaaagttat
aatcttacaagattccgcatgccagctttaaaaactatcgaaacaaccagagacaacttt
ataataaacgtggaaaaagttcacgacgacttttgtttcacgccctccgaaatgctcttt
ttcttgaaaaatgaagtgatattcagtaaaattgaagcgaaaatttgtcaaaacgtgacg
gaagaggacggcgaagacgattgtattttcgatggaatgagcaaacttgataacaattgc
agcgatgtattagggaaaataacgataggctctggagatgaagcatatgttgaaaaactg
agaaatgtgaaaaatatctatggaggaataaggattgagaacacgaacttgacaaacttg
gagtttttggggagtttggaatatgttgcaagcttgaatgattctgccgttccttttcaa
ataagctcaaacaagcttctacagaatgccagcttacccaatttgaagcgagtattttcc
acaagcagatatcaaatcggatttcaagagaatggaaatgattttctcaactcgactgct
tgtcttttccttatgaatcaattatttttgacaaacgttgtttttgatggaaatgagtgt
gaagccattgacagaaccaatcagaacaatggtgccaattggattttcagattgaatttt
tttattttattgttatgggtttcactctaa

DBGET integrated database retrieval system