KEGG   Caenorhabditis elegans (nematode): CELE_Y47D3B.7
Entry
CELE_Y47D3B.7     CDS       T00019                                 

Gene name
sbp-1
Definition
(RefSeq) BHLH domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: HLH Inhibitor_I53 Cnn_1N
Other DBs
NCBI-GeneID: 176574
NCBI-ProteinID: NP_499472
WormBase: WBGene00004735
Ensembl: WBGene00004735
UniProt: Q9XX00
Position
III:complement(join(11428418..11428609,11428665..11429025,11436957..11437110,11437157..11437384,11437444..11437840,11438150..11438678,11438724..11438917,11439441..11439676,11440021..11440440,11440494..11440602,11441374..11441683,11441942..11442074,11442487..11442565))
AA seq 1113 aa
MNEEFEGDVPMSDPFLSLVTKLDDIAPFPNNDPLDFDMEHNWQEPGPSQQPDPSIPGNQH
SPPQEYYDIDGQRDVSTLHSLLNHNNDDFFSMRFSPPNFDLGGGRGPSLAATQQLSGEGP
ASMLNPLQTSPPSGGYPPADAYRPLSLAQQLAAPAMTPHQAASLFVNTNGIDQKNFTHAM
LSPPHHTSMTPQPYTEAMEHINGYMSPYDQAQGPSGPSYYSQHHQSPPPHHHHHHPMPKI
HENPEQVASPSIEDAPETKPTHLVEPQSPKSPQNMKEELLRLLVNMSPSEVERLKNKKSG
ACSATNGPSRSKEKAAKIVIQETAEGDEDEDDEDSDSGETMSQGTTIIVRRPKTERRTAH
NLIEKKYRCSINDRIQQLKVLLCGDEAKLSKSATLRRAIEHIEEVEHENQVLKHHVEQMR
KTLQNNRLPYPEPIQYTEYSARSPVESSPSPPRNERKRSRMSTTTPMKNGTRDGSSKVTL
FAMLLAVLIFNPIGLLAGSAIFSKAAAEAPIASPFEHGRVIDDPDGTSTRTLFWEGSIIN
MSYVWVFNILMIIYVVVKLLIHGDPVQDFMSVSWQTFVTTREKARAELNSGNLKDAQRKF
CECLATLDRSLPSPGVDSVFSVGWECVRHLLNWLWIGRYIARRRRSTTKPVSVVCRSHAQ
TAVLYHEIHQLHLMGITGNFEDTYEPSALTGLFMSLCAVNLAEAAGASNDGLPRAVMAQI
YISASIQCRLALPNLLAPFFSGYFLRRARRHVRRAPEHSVSHLLWIFHPATRKFMSDAKR
LEHVLSSKQKQLRFGSFVEDEQLSPLARIRTTLKVYLLSKLVQELVGGDEIFTKNVERIL
NDNDRLDDEVDVVDVSRLLVTISTQCAAILTNEKDESAKFGTWISRNGDACCTWWTHVLT
CGIYWRSNKNELARQHYSLIRNCPPKILTDNLGLAVGHALCARKICIDDRDSPKVSQYVC
IHTKKSLESLRLFSTSSRASGVVSGIQEGTRRMAYEWIMNSLLDAWRSNLFASKPYWTQS
FKGQSTFSTLYQEAYNHYAIINGTRGDCWRLFVYELTCRMLNGANPQATWSGVRRVRSTK
MDAVRGRVSMRRSAQPDAFHLHTLVKLHTSMDL
NT seq 3342 nt   +upstreamnt  +downstreamnt
atgaacgaagaattcgagggagacgtccctatgtcggatccgtttctctcattggtcaca
aaattggatgatattgcgccatttccaaataacgacccgctcgattttgacatggagcac
aactggcaagagcccggaccatcacaacaaccggatccatcaattcccggaaatcaacac
agtccgccacaggaatattatgatattgatggtcaacgagacgtaagcaccttacactcc
ctgctcaaccacaacaacgacgacttcttctcaatgcgattttccccgccaaactttgat
ctcggcggaggccgtggaccttctctagccgccacccaacaattatctggagaaggtcct
gcaagtatgcttaaccccttacaaacatctccaccaagtggaggttaccccccggcagat
gcctacagacctctatcacttgctcaacaactcgccgcgccagcgatgactccacatcag
gcagcgtcgctttttgttaatactaatggaattgatcaaaagaatttcactcatgcaatg
ctatctccaccacaccatacctcaatgactcctcaaccatatacagaagcaatggaacat
atcaacgggtacatgtctccatacgaccaagctcaaggcccatcaggaccatcatattac
tcacaacaccatcaatctccaccacctcatcaccaccatcaccacccgatgccaaaaatc
catgagaaccctgaacaagtggcatctccatcgattgaagatgctccagagacgaaacca
actcatttggttgaaccacaaagtccaaaaagcccgcagaatatgaaagaggagcttctt
cggttactagttaacatgtctccgagtgaagttgaacggttaaagaataaaaaatcagga
gcatgttcagcgacgaatgggccatcgaggagtaaggagaaggcggcgaagattgtgatt
caggagacagcggaaggggatgaagatgaggatgatgaggatagtgattccggggagact
atgtctcagggaactactattattgttcgaagaccaaaaaccgagcgtcgtacggcacac
aatctcatcgaaaagaagtatagatgctcaataaatgatcgaattcaacagctgaaagta
cttttgtgtggggatgaagctaagctttcaaaatcggcaacactacgacgggctattgaa
catatcgaggaggttgaacacgagaatcaggtgttgaagcatcatgttgaacaaatgaga
aagacactgcagaataatcgattaccgtacccggaaccaattcaatacactgaatactct
gcccgatcacccgtcgaatcatctccttctccacctagaaatgagagaaaacgatcacga
atgagcacaacgactcctatgaagaatggaactagagatggatcttcgaaagttaccctt
tttgcgatgctcctagcagttctgatttttaatccgattggattgctcgctggaagtgcg
atattctcaaaagccgctgcagaagctccgattgcctccccgttcgagcatggaagagtg
attgatgacccggatggaactagcactcggacgcttttctgggaagggagtatcatcaat
atgagctatgtctgggtgttcaacatcttaatgatcatatatgtggttgtcaaactgctg
atccatggtgaccctgttcaagacttcatgtccgtttcatggcagacttttgtgacgact
cgagagaaggcgagagccgagttgaactctggaaatttgaaagatgctcagagaaagttc
tgcgagtgtcttgcaacgttggatcgatcgcttccatcaccgggggttgattcggtgttt
tcggttggctgggaatgcgttcgacatcttttgaattggttgtggatcgggagatacatc
gcaagaaggcgcaggtccaccacgaagcctgtctcagtcgtttgtaggagtcatgcgcag
actgcagttctctatcatgaaattcatcagctccatctaatgggtatcactggaaacttc
gaagacacctatgaaccatccgccctaacgggcctcttcatgtccctctgtgcagtaaac
cttgctgaagctgccggagcatcaaacgacggacttccacgcgccgtcatggctcagatc
tacatttctgcatccatccaatgccgtttggctcttccgaacctactcgcaccattcttc
tcgggatactttttacgaagagctcgaaggcacgtgcgtcgagctccggagcactcggtg
tcccatttgttatggatcttccatccagcgacaagaaagttcatgtcagatgcgaaaagg
ttggagcatgtgttgagctcgaagcagaagcagttgagatttgggtcttttgtggaagat
gagcaattatccccacttgctcgaatccgaacaacgctgaaagtgtacctactctccaaa
cttgtacaggaacttgtcggtggtgacgagatctttacaaaaaatgtggaacgcatccta
aatgacaatgaccgtctcgatgatgaagtagacgtggttgatgtttcaagacttttggtg
acaatttcaacgcagtgcgctgccattttgactaatgagaaggatgagtcagcgaaattc
ggaacctggatctctcgaaacggagatgcttgttgcacatggtggacgcacgttctgaca
tgtggaatctattggaggagtaacaagaatgagctggcacggcaacactattcactgatc
aggaactgtccgccgaagattttgacagacaatctgggtttggcggttggccacgcgttg
tgtgctcgcaagatttgcatagatgaccgagattccccgaaagtcagtcaatacgtgtgc
attcacacaaagaagtcgctcgaatccctccgactattctccacatcatcgcgagcatca
ggtgtggtgtctggaattcaggaaggtacacgccgaatggcctacgaatggattatgaac
tcgctgctcgacgcgtggcgttccaatctattcgcatcgaaaccctactggacacaaagc
ttcaagggacaatccacgtttagtacgctttatcaagaggcgtataatcattatgcgatt
attaatgggacaaggggagattgttggagactatttgtctacgagctcacgtgccgaatg
ctcaacggagccaacccacaagccacgtggtcaggcgtccgacgcgttcgatctacaaaa
atggacgcggtccgaggaagagtgagcatgcgacgctcggctcaaccggacgcatttcat
cttcatacactggttaaactacatacttctatggatctttga

DBGET integrated database retrieval system