KEGG   Caenorhabditis elegans (nematode): CELE_Y48E1B.13
Entry
CELE_Y48E1B.13    CDS       T00019                                 

Gene name
csp-1
Definition
(RefSeq) Caspase A subunit P16
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Peptidase_C14 SPK
Other DBs
NCBI-GeneID: 175007
NCBI-ProteinID: NP_001022452
WormBase: WBGene00000819
Ensembl: WBGene00000819
UniProt: G5EBM1
Position
II:join(13601204..13601206,13601457..13601585,13601833..13602182,13602544..13602685,13602949..13603087,13604005..13604258,13604303..13604509,13604556..13604657,13604702..13604938,13605010..13605057)
AA seq 536 aa
MVLKTIEDNCKSQFDDDLVEDFNNFQTTSSMSSSTTISTEDFNTIEIESTFEICRSGSYT
EEPILGENDEFLIDFEMERFLKFLKDKTKQVEKRKEPFSQKEIYAVFQRRIKSELCIETV
KKKFQPLLPNAIQTCEFDEETMIRMIYGAGIRIDSVDFWNRFTSKATISLDCYSRLISYS
SDSLTLSGTHRSGFTYHWISTPPVTYHRTENKDPNIQEPSPVEFLDVQSSLGSSMKPPIL
DKPTKLDDPAETRHDCSYSLEEYDSQSRMPRTDAKKSNHKHKYCYEMNSNPRGTVLILSN
ENFKNMERRVGTKQDEVNLTKLFQKLQYTVICKRNLEAESMLEAIKEFAEMAHTDSIILF
LLSHGDGAGSVFGIDDMPVNVMEVSTYLAYHQNLLLKPKWVAVSACRGGKLNMGVPVDGL
PALEDKCAPISKFWNLMMSRIMPGTFTSLNADVIISFSTTDGFTSYRDEEAGTWYIKSMC
KVFNKHSKTMHLLDILTETGRNVVTKYENVQGNVVLKQAPEILSRLTKQWHFSRSM
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggtcctgaaaacgatagaagataattgtaaatcacaattcgacgatgatttggtcgaa
gatttcaataattttcaaacgacttcttctatgtcttcatcaacaacaatatctactgaa
gattttaatacgatcgaaatcgagtcaacattcgaaatatgcagaagtggctcctataca
gaagagccaattcttggagaaaatgatgaatttttgattgattttgaaatggaacgattt
ctgaaattccttaaagacaaaacaaaacaagtagaaaaaagaaaagaacctttctcccaa
aaggaaatatatgcagttttccaacgacgcattaaatctgagctctgcattgaaacggtg
aagaaaaagttccaaccactccttcccaatgcaattcaaacatgcgagttcgacgaggaa
actatgataagaatgatctatggtgcaggaattcgaatagactctgtggatttctggaac
cggttcacatcgaaagcgacaatttcactagactgctactcaagattgatctcatactct
tccgactctctgaccttaagtggtactcatcgttctggattcacatatcattggatatcc
acaccccctgttacttatcataggactgaaaataaggatccaaatatacaagagccatct
ccagttgaatttctagatgtacaatcgagtctgggttcaagtatgaaaccaccgatactt
gataagcccaccaaactagatgacccagctgaaacccgccatgactgctcgtattcactg
gaggagtatgactctcagagtcgaatgccgagaacggacgccaagaaatcgaaccataaa
cacaagtattgttatgagatgaattcaaatccgagagggaccgtcctcatattaagtaac
gagaacttcaagaatatggagagaagagtcggaacgaaacaagacgaagtaaatctaacc
aagttgttccaaaagcttcagtacacagtaatttgcaaacggaatcttgaagctgaaagc
atgcttgaagctatcaaggaattcgcggagatggcacataccgattcgatcatactcttc
ctattaagtcatggtgatggagctggaagtgtctttggaattgatgacatgcctgtcaat
gtaatggaggtatccacatatttagcgtatcatcaaaatcttcttctcaagcccaaatgg
gttgccgtgtcagcatgtcgcggaggaaaattgaacatgggtgttcccgttgacggactg
ccagctttggaagacaaatgtgctccaatctcgaaattttggaatttaatgatgtcacgt
ataatgccgggaaccttcacttcattgaacgccgacgtcatcatctcgttttccaccacg
gacgggtttacgtcttatcgagacgaagaagcgggcacatggtatattaaatccatgtgt
aaagtcttcaataagcattcaaaaactatgcaccttctcgatatattaacggaaactggt
agaaatgttgttacgaagtatgagaatgttcaagggaacgttgtattaaaacaagcccca
gagatattatccaggctcaccaaacaatggcacttttcaaggtcgatgtaa

DBGET integrated database retrieval system