KEGG   Caenorhabditis elegans (nematode): CELE_Y48G9A.8
Entry
CELE_Y48G9A.8     CDS       T00019                                 

Gene name
ppk-2
Definition
(RefSeq) PIPK domain-containing protein
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00562  Inositol phosphate metabolism
cel01100  Metabolic pathways
cel04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CELE_Y48G9A.8 (ppk-2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CELE_Y48G9A.8 (ppk-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     CELE_Y48G9A.8 (ppk-2)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 175344
NCBI-ProteinID: NP_497500
WormBase: WBGene00004088
Ensembl: WBGene00004088
UniProt: Q9BL73
Position
III:join(2102317..2102499,2102718..2102960,2103820..2103932,2104725..2105011,2106025..2106359,2107121..2107165)
AA seq 401 aa
MSTKKKTKVLSKKKGKILVPKWKLFRAKEPVLSVFMWGINHTVDQLLHVPPPGLLMPDDF
KAYSKVKIDNHNFNKDIMPSHYKVKEYCPNVFRNLREQFGVDNFEYLRSLTSYEPEPDLL
DGSAKDSTPRFFISYDKKFVIKSMDSEAVAELHSVLRNYHQYVVEKQGKTLLPQYLGLYR
LTIEGSETYLIVMRNVFGRKYGVHTKFDLKGSTVSRAASDKEKAKDLPTLKDNDFLEQNW
KLNLPPEAGKLLIEMLTSDTEWLTRMHLMDYSLLVGIHDCERAAQEAANRPVEQNSEESG
DELAPTPPDSPIPSTGGAFPGVSGGPDLDDEFYAIASPADFEKNLIYFIGLVDILTYYGI
KKRSATAAKTVKYGSDAENISTVKPEQYAKRLVEFVSRALN
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgtcgacaaaaaagaagacaaaggtcctatcgaagaaaaaaggcaagattttggtgcca
aaatggaagcttttccgcgccaaagagcctgtcttgtcggttttcatgtggggaatcaat
catacggtggatcagctgcttcatgtccctccgccagggcttctaatgccagatgacttc
aaggcatattcgaaagtaaaaatcgataatcacaatttcaacaaagatattatgccgtca
cactacaaagtcaaagaatactgtccaaatgtgttccgtaaccttcgtgagcaatttggt
gtcgacaatttcgaatatctacgctcgctgacgtcatacgagccggagcccgacttgttg
gatggctcggcaaaggattccacgccgagattctttatatcgtatgataagaagtttgtg
atcaagtcaatggactccgaagcggtcgccgagctccactcagtactccggaattatcat
caatatgtcgtcgaaaagcaaggaaaaacccttttgccgcaatatttgggactttataga
ctaacaatcgagggctcagagacatacctgatcgtaatgcgcaacgtgttcggccgaaag
tacggtgtccatacaaaattcgaccttaaaggatctacagtatcccgtgcggcgtcggat
aaggaaaaagccaaagatctcccaacactgaaagataacgattttctggaacaaaactgg
aagcttaacctgccgccagaggccggaaaactgctcattgagatgctcactagtgatacg
gaatggctcacgagaatgcatttgatggattattcgctgctagttggtatccacgactgc
gaacgtgccgcccaagaagccgccaatcgtcccgtagaacaaaacagtgaagaatcgggc
gacgagctcgccccgacgcccccagactcgccgatcccgtcaacgggcggcgcatttccc
ggagtttcgggcggtcccgacctcgatgatgaattttacgccatcgcaagtcccgcggat
tttgagaaaaatttgatctattttattgggctcgtcgatattctcacctactacggcatc
aagaaacgcagtgcgacggccgcgaaaactgtgaaatatggctcagatgccgagaatatt
agcactgttaaaccggaacagtatgccaaacgactcgtcgaattcgtaagccgggctctc
aactga

DBGET integrated database retrieval system