KEGG   Caenorhabditis elegans (nematode): CELE_Y49C4A.9Help
Entry
CELE_Y49C4A.9     CDS       T00019                                 

Gene name
cyp-33C11
Definition
(RefSeq) CYtochrome P450 family
  KO
K17955  cytochrome P450 family 33
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cel00199]
    CELE_Y49C4A.9 (cyp-33C11)
Cytochrome P450 [BR:cel00199]
 Cytochrome P450, animal type
  CYP33 family
   CELE_Y49C4A.9 (cyp-33C11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 190065
NCBI-ProteinID: NP_503303
WormBase: WBGene00021710
Ensembl: WBGene00021710
UniProt: Q965T7
Position
V:complement(join(710642..710743,710794..710967,711010..711523,712180..712678,712723..712921))
Genome map
AA seq 495 aa AA seqDB search
MIAFSIFIAIFFWLAHCFYFKRRNLPPGPTPLPFLGNSLSMIWENPGYECFRRWTRIYGD
VFTFWLGDTPYVVISSLEKMKETFIKDGETYQDKIQFSFTEKFRGGRFGVIETTGHMWST
HRRFAISTFRDLGLGKNLMQEKILAEVEAVFQILDANLGAEQDVPEVIYNAVANVINQMI
FGYRFDESNQNEFEKLKDLIDIQEKSFASFKLCVQAFVPIMNKLLPGKSLEDLIAEKRHD
YYNFFYAQIQDHRAKINYQAEEYLDYAEAYLKEQKNQEQGGLGSDLFSDQQLANMCFDLW
FAGLTTTNTTINWTISYVLNHPEVQDKMQEELDKVVGSDRLVTISDKSSLPYMNAVINES
QRCVNLLPCNLFHATTRDTVINGNIIPKGTGVIAQISTVMLDEKIFPDPYKFQPERFIDE
NGALKKIEQLIPFSVGKRQCLGEGLARMELFLIVANLFNRYFITPSSAGPPSLERTEMVG
VFPRKFQAILTRRYE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgatagctttttcaattttcatcgccatttttttctggctggctcattgtttctatttc
aaacgccgaaatctcccaccaggacctacaccacttcctttccttggcaattccctatca
atgatatgggagaacccgggctacgagtgttttagacggtggactagaatctatggggat
gtttttaccttttggctgggagacacaccctacgtcgttattagctctcttgaaaaaatg
aaggaaacttttatcaaagacggagagacttatcaggataaaatccaattttcattcacc
gagaaatttcgaggtggaagatttggagtaattgagacaactggacacatgtggagtact
catagaagatttgcaatttctacttttcgagatttggggctcggcaaaaatttgatgcaa
gaaaaaattctggccgaggttgaagcagtgtttcaaatattagatgcaaatctgggtgct
gagcaagatgtgccagaggtgatatataacgctgtggccaacgtcataaatcagatgata
tttggctatcggtttgatgaatcgaatcagaatgaatttgaaaagttgaaggatttgata
gatatccaagaaaaatcatttgcttccttcaaactttgcgttcaagcttttgtaccaatt
atgaataaattgctgccgggaaaatcattggaagatttgatcgctgaaaaaaggcacgac
tattacaactttttctacgcccaaatccaagaccaccgcgccaaaatcaattaccaagcc
gaagaatatcttgattacgctgaagcctacctcaaagaacagaaaaaccaggagcaaggt
ggtctcggctctgatttgttctccgaccagcagctggctaatatgtgctttgacttgtgg
tttgctgggctcaccacaactaacactacaataaattggacaataagctatgttttgaac
cacccggaagttcaagataagatgcaagaggagctggataaggtggtgggaagtgataga
ttggtgacaatatctgataaaagcagccttccgtacatgaatgcggtgatcaatgagtct
cagagatgtgtaaatttacttccctgcaatttgtttcacgcaactactagggatactgta
attaatggaaatataattccaaaaggaacaggtgttattgcccagattagtacagttatg
ctggatgagaagatcttccccgacccctataaattccaacctgaaagattcatagatgaa
aatggagcactgaaaaagatcgagcagctaatcccattttcagtcggaaaacggcagtgc
ctcggtgaagggctagctcggatggagcttttcctgattgtcgccaatctattcaatcga
tattttatcacaccatccagtgctggacctccatcattggagagaaccgaaatggtcggg
gtattcccaagaaaatttcaggcaattttgacgagaagatatgaataa

DBGET integrated database retrieval system