KEGG   Caenorhabditis elegans (nematode): CELE_Y50D4C.4Help
Entry
CELE_Y50D4C.4     CDS       T00019                                 

Gene name
sqv-6
Definition
(RefSeq) Xylosyltransferase sqv-6
  KO
K00771  protein xylosyltransferase [EC:2.4.2.26]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
cel00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
cel01100  Metabolic pathways
Module
cel_M00057  Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    CELE_Y50D4C.4 (sqv-6)
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    CELE_Y50D4C.4 (sqv-6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cel01003]
    CELE_Y50D4C.4 (sqv-6)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.26  protein xylosyltransferase
     CELE_Y50D4C.4 (sqv-6)
Glycosyltransferases [BR:cel01003]
 O-Glycan biosynthesis
  Glycosaminoglycan
   CELE_Y50D4C.4 (sqv-6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Branch WSC Xylo_C
Motif
Other DBs
NCBI-GeneID: 190099
NCBI-ProteinID: NP_503359
WormBase: WBGene00005024
Ensembl: WBGene00005024
UniProt: Q965Q8
Position
V:complement(join(951605..951878,952909..953093,954536..955015,956327..956774,958605..959016,962180..962654,964631..964777))
Genome map
AA seq 806 aa AA seqDB search
MLFNGTTKYRDYAIVISLFFLLNVYLLYNTAQHTQVGNSKHISSDSGEKTSNPLPSCEIT
DDLAKSAISRAITPSCKAKLQLEACQLKNGTFTINFPENQCPNHDSRLIDQRIGCFLDKK
EARVLTEFEYKLPKSNGKATCRKHCYKAGFLYFGLEFGHECFCGNDVSNATAVDDVECRA
YKCPGNENSEEFCGGFNAVEIFRTGFRSKVNHRKPTYLPPSSDSIKNPVKILFLLQLNGR
NERQVKRFLKSIYLPHHYYYIHVDARQNYMFSEMQKVADFLDNIHITERRFSTIWGGASL
LQMFLQVIRDSMKIEKFKDWDYIINFSESDFPILPISDFERLITVNNGKSFLASHGYNTG
KFIQKQGFEYVFSECDNRMFRIGKREFPQNLRIDGGSDWVGIHRNLAEFSISDEELPRKL
RKTYESILLPLESFYHTLAFNSEFCDDLLMSNLRLTNWYRKQGCRCASLKPIVDWCGCSP
LVFREETMKKFELQKAISKPTYFARKFDSMVDIDSIEAAEMQSISPEKLQLNHPTYHFAF
ANIFKTGIDEQKLHFESLANFALKSTETRAKFRKVLRIDALRAHHNALIEIVMKIETTDG
ATFEFLIHRLSHVNLTENEEKLVEHGYLLRAVSFGTKFEWKEELCREYMGFVTDNDTLHT
RLQWHPTEHVKKVGDKTSPEMIFKYRKGDELIEQTVVKPYDSVFGGQFDSWNVGKKLSNL
TTCSNFFVDIISPSSPDDAPPLATLHFPVYTDQNAHCHVDYLRQFFKIADFCTSGDACKE
KIWSTSYPDPKSDIFVGYDEDTQTLI
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgttattcaacgggacgactaaatatcgagattatgcgattgtgatatcattattcttc
ctgctaaacgtctatttattgtacaatacggctcaacacacgcaagtcggaaattcgaag
catatttcgtcggatagcggtgaaaaaacgtcgaatcctcttccatcatgcgaaatcaca
gatgacctggcgaaaagtgcaatttcccgtgcaattactccatcctgcaaagcaaaactg
cagctggaagcttgtcaactgaaaaatgggacttttacaataaattttccggaaaatcaa
tgcccgaaccacgatagccggcttatcgaccaacgaatcggctgttttttggacaaaaaa
gaggctcgagtgctcacagagttcgagtacaaacttccaaagtcaaatgggaaagcgacg
tgtcgaaagcactgctataaagctggttttttgtatttcggacttgaattcggacacgaa
tgcttctgtgggaatgatgtatcaaatgcgacggcggttgatgacgtggaatgtcgggcg
tataaatgtccgggaaatgagaactcggaggagttctgtggtggattcaatgcagtcgag
atttttaggacaggatttagaagcaaagtgaatcaccgcaagccgacatatcttccacct
agcagcgattctatcaaaaatcccgtcaaaattctcttccttcttcaattaaatggtaga
aatgagcgtcaagtgaaacgatttctcaaatcaatttatcttccacatcattattactat
atccacgtggatgcacgtcagaattacatgttctcagaaatgcaaaaagttgctgatttt
ctggataatattcatataaccgaacggagattcagcacaatttggggtggagcatcactt
ttacaaatgtttctgcaagtgattagggattcgatgaaaattgagaaattcaaggattgg
gattatattattaatttctcggaaagtgatttcccgattctaccgatttccgattttgag
agacttatcactgtaaacaacggaaaatcattcctggcctcacacggctacaacactgga
aaattcattcaaaaacaaggattcgaatacgtgttctccgaatgcgataatcgaatgttc
cgtatcggaaaacgcgaatttccacaaaatctacgaattgacggcggatccgattgggtt
ggaattcatcgaaatctcgccgaattttcgatttccgacgaggaattgcctcgaaaattg
cgaaaaacgtatgaaagtatacttctaccactggaatcattctatcatactcttgcgttc
aattccgaattctgtgatgatctactgatgagcaatttgcggcttacgaattggtacagg
aaacagggatgtcggtgtgcttcattgaagcctattgttgattggtgtggatgttcgccg
ctggtttttcgtgaagaaactatgaagaaatttgagcttcaaaaagccatctccaaacca
acctactttgcccgaaaattcgatagtatggtagatatcgattcaattgaagccgccgaa
atgcaatcaatttcacctgaaaaacttcaattaaatcatccaacctatcatttcgctttt
gcaaatattttcaaaactggaatcgacgagcagaagcttcatttcgaaagtttggcgaat
ttcgcgctgaaatccaccgaaactcgggcaaaattccgaaaagttttgcgaatcgatgct
cttcgagctcatcataatgctctcatcgagattgtcatgaaaatcgaaacgacggacggc
gcgacgtttgaatttttgattcatagactgtcccatgtgaatttgacggaaaatgaggag
aagcttgtggagcacggatatctattgagagctgtatcgtttggaacaaaatttgaatgg
aaagaggagctttgcagggaatatatgggatttgtcactgataacgacactcttcacacc
cgcttgcaatggcatccgacagaacatgtgaaaaaagttggagacaagacgagtcccgaa
atgatattcaaatatcgaaaaggcgatgagctcattgagcaaactgttgtaaagccgtac
gattcagtgtttggaggacaatttgatagttggaatgttgggaaaaaactctccaacctg
acgacctgttccaatttcttcgtcgacatcatctccccatcgtcacccgatgatgctcca
ccgctcgccacactacattttcccgtttacactgatcaaaacgcgcattgccacgtggat
tacctacgccagttcttcaaaattgccgatttttgcacttccggcgacgcttgcaaggaa
aagatctggagtacgagctatcccgatccgaaatcagatatttttgtcggatacgatgag
gatacgcagaccttgatttag

DBGET integrated database retrieval system