KEGG   Caenorhabditis elegans (nematode): CELE_Y51H4A.17
Entry
CELE_Y51H4A.17    CDS       T00019                                 

Symbol
sta-1
Name
(RefSeq) Signal transducer and activator of transcription 1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    CELE_Y51H4A.17 (sta-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_Y51H4A.17 (sta-1)
Transcription factors [BR:cel03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    CELE_Y51H4A.17 (sta-1)
SSDB
Motif
Pfam: STAT_bind STAT_alpha SH2
Other DBs
NCBI-GeneID: 178465
NCBI-ProteinID: NP_502974
WormBase: WBGene00013111
UniProt: Q9NAD6
Position
IV:join(16664322..16664630,16665227..16665571,16665964..16666091,16666256..16666493,16666869..16667515,16670541..16670675,16670718..16670840,16671064..16671259)
AA seq 706 aa
MMGSSSQELQTALTDVSKTCHHLWEENKDLQGRFVNELGELQRLQMVIAQLEQQQRLENV
FTVKQQMTELQKRAATLYEHLTQKRNDIVIKLNDGTNFATMLQTQLIGEKLFSWKNAQKL
AQIGMPFDNREQLLDEIQIEFEFLADQNWQLNMFSCWMLDLLRRAPQLNDGLAQATIGKL
TAITEQLNKLLFMLVSQSFIVSVQPEPVLKTQHKFVTEVRLLIGDKLGIRQHLVNTNVSV
KIIAEDEAKQLSVDYDAHKEIRNNKTVGTISNDFEKLTMNERGHLAAKFNNSKLTRIAHR
KPPPKGASDLKCAASMQAATDQKYALLFFITPFQMGNLSKEEQFDVWTLSLPIMVTVHGS
QDCDAQVAILWHRAFASISRNPNTTDVTAVTWDNLAIMLRNKFSLFTGARRPLSDSDLAY
LSEKMLMPNVADQKPITFHRFAKQAMRDDLPFSFWEWFFSIMQLIKQKLLKFWDEGWCIG
FISKNDASQSMMMCQHSSFLLRFSDSQTGAVSIGFVCEEADGQKIPFHLAPFTIKDLDQL
SLASRIASCPQLKDIRYMYPAIDKEEMLRFFESEERHRVGGGDSPTGYIQSEIVMVAKTN
GNFRRMSNAPSMFGADSPSPLSVQSKLDWSPGEVHQNHMMEMSDELGQILTVSDMSGDVE
TLLGPAFKNNITNYNPHDGNHQHNLHFVDMSQQGMMQQHHNQFYPS
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgatgggctcatcgtcgcaagagcttcaaacagctctaaccgacgtctcaaagacctgc
catcacttgtgggaagagaataaggacctccaaggcagatttgtgaatgaactcggcgag
cttcaacgtctgcaaatggtcattgcacagctggaacagcaacagagactagaaaatgta
ttcactgtgaaacagcaaatgacagagttacagaaaagagcagccacactttatgagcat
ttgacacagaaaagaaatgatattgtcattaaacttaatgatggcaccaattttgcgacg
atgctacagacccaactaattggcgaaaagctgttctcctggaaaaatgcccaaaaactt
gcccaaatcggaatgcctttcgataatcgcgaacagctgcttgatgaaattcaaattgaa
ttcgaatttctcgctgatcaaaactggcagcttaacatgttctcgtgttggatgctcgac
ttgctccgacgtgctccacagttaaatgatgggctcgctcaggcaacaattggaaagttg
actgcaattacagaacaattgaacaaattactttttatgctggtttcacagagttttatt
gtttccgttcaaccggaacctgttttgaagactcaacataaatttgtcactgaggtccgt
cttctcattggcgataagctgggaattcgtcaacacctggtgaacacaaatgtttcagtg
aaaattatagcagaagatgaagccaagcagttgagtgttgactatgatgcacataaggaa
atccgtaacaacaagacagttggcacaatttccaatgatttcgagaagctcacaatgaat
gaaagaggacacttggcggcaaaattcaataattcaaaattgacaagaattgcacacaga
aaaccgcccccaaaaggagcatctgacttgaaatgtgcagcaagtatgcaggcagctact
gatcagaaatatgctcttttattctttattacaccttttcaaatgggtaatttgagcaaa
gaagaacaattcgacgtttggacactttctcttccaataatggttacagtacacggatct
caagactgtgacgcgcaagttgcaattctctggcaccgcgcattcgcctcaatcagcaga
aatccaaatacaactgatgtgacagctgtgacatgggacaatctagcaataatgcttcga
aacaagttctccttattcacgggagcacgtcgtccactttcagattcagatttggcatat
ttaagtgagaaaatgttaatgccaaatgtggcagatcagaagccaatcacatttcatcga
ttcgcaaaacaggcaatgagagatgacttaccattctcattttgggaatggtttttctca
ataatgcaattaatcaaacaaaaactgctcaaattctgggatgagggatggtgcattgga
tttatttcaaaaaatgatgcgtctcaaagtatgatgatgtgtcagcactcttcattttta
ttgagattctctgacagtcaaactggtgctgtatcgattggttttgtttgtgaagaggct
gatggacaaaagattccatttcatttggcaccttttactattaaggatttggatcaattg
tcactggcaagtcgtattgcttcatgtccacaattgaaggatattcgatacatgtacccg
gcaatcgataaagaagaaatgctgcgtttcttcgagtccgaggagcgtcatcgcgtgggc
ggtggtgacagtccaactggatatattcaaagtgaaattgtcatggttgcaaaaacaaat
gggaatttcagacgaatgtccaatgcaccgtccatgtttggtgcagattctccgtcaccg
ttgtcggttcaaagcaaattggattggtcacccggggaggttcatcagaatcatatgatg
gagatgtccgacgaacttggtcaaatcctaacagtctcggatatgtcgggagatgtagaa
actctattgggaccagcattcaagaataatatcacaaactacaatccacacgatggaaat
catcagcataaccttcattttgtggatatgtcccaacagggaatgatgcaacagcaccac
aatcaattttatccctcataa

DBGET integrated database retrieval system