KEGG   Caenorhabditis elegans (nematode): CELE_Y53C12A.1Help
Entry
CELE_Y53C12A.1    CDS       T00019                                 

Gene name
wee-1.3
Definition
(RefSeq) Membrane-associated tyrosine-and threonine-specific cdc2-inhibitory kinase wee-1.3
  KO
K06633  membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_Y53C12A.1 (wee-1.3)
   01009 Protein phosphatases and associated proteins [BR:cel01009]
    CELE_Y53C12A.1 (wee-1.3)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_Y53C12A.1 (wee-1.3)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: Other
  WEE family
   CELE_Y53C12A.1 (wee-1.3)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CELE_Y53C12A.1 (wee-1.3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 174531
NCBI-ProteinID: NP_496095
WormBase: WBGene00006940
Ensembl: WBGene00006940
UniProt: O18209
Position
II:complement(join(9714102..9714134,9714183..9714618,9714684..9714997,9715044..9715181,9715231..9715578,9715627..9716135,9716207..9716462))
Genome map
AA seq 677 aa AA seqDB search
MDDTEGNSSMDSIRNGQSSPLPQVTPRLPQIPMMMRETPLSTKRERQAITPRFRRPAPKM
IKTMPPTRSIWSVRKESVPLLVTPQGPKPLESPKYDHTNAQSFFEQVFQIDEIIGRGSFG
EVFAARCREDSQLYAVKVSLAPIRQHSISKYREAESHMIIPPHKNLVKFYRAWEETGRLY
IQTELCDQSLLKYCTEKHALPEDEIWNIFVDLLQAVHHLHSNDMIHDDIKPENIFLTKDM
ICKLGDFGLVINLKNPNDVKSAEEGDSKYLAPEVLNGRPTKSSDIFSLGMTILEATTDLD
VPSNGDSWHQIRNGQIPDRFFAGISTDLRSLIALMLDSDPRIRPTSRDLLDHPVIKKKLM
KRGTYVKCISILNGFFYAFSAVLVWVMAFFSVLFHPIVRFHAAIKDRQSEICAQFVNNQQ
HTPIQTPETSKVYLESLTGVAVRQASQIVSPFDFSDDENPPNAQRRLFTGAVPCRLNFDN
DQDDDEEQATCSSSNSSAIEPQLDEPESPPRMNDVIDKLGKRGTPRSARRNLTFNRHRQV
AASVAPKSSLNHYNHHTGSGDGFSNNSLIPISDQERTEKYLRMRLTEQQLDWADQNNVID
EAPPPMSCPPRIRRSIRDLPRMPVLNFNVLDEPSNKPTVDHHTILEQSESPRRRLNRGAK
PVPRNRMMSFGSSGDEV
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggacgacacagagggtaactcctcgatggattccattcgaaatggtcaatcaagtcca
cttccacaggtcactccacgcttaccacaaatcccgatgatgatgcgtgagacaccactt
tccacaaaacgtgagcgccaagcaattactccacgtttccgtcgtccagctccgaaaatg
ataaaaactatgccaccaacaagaagcatttggtctgttcggaaggagtcggtcccactt
ttggtcactccgcagggaccaaaaccactggaatcgccaaagtacgatcatacaaatgct
caatcattctttgaacaagtatttcaaatcgatgaaatcattggaagaggctcgttcgga
gaagtattcgcagccagatgccgtgaggattcccaattgtatgctgtcaaagtatcgtta
gctccgatccggcaacattcaatttccaagtaccgagaagctgagagccatatgatcatt
ccaccgcataagaatcttgtcaagttctacagagcctgggaggaaactggtcgattgtat
attcaaacagaactttgcgatcaaagtcttttgaaatattgtacagagaaacatgcacta
ccggaggacgaaatttggaatattttcgtagatttgctccaagctgttcatcatttgcac
tcgaacgacatgattcatgatgatattaaaccggaaaacatttttcttacaaaggacatg
atatgcaaactcggagattttggtttggttattaaccttaaaaatccaaatgatgtgaaa
tcagcggaagaaggtgactcgaaatatcttgctccagaagttttgaacggccgtcccacg
aaatcatcagacattttcagtctaggaatgacaattcttgaggctactactgatcttgac
gttccatcaaatggagattcgtggcatcaaatcagaaatggacagattcctgatagattc
ttcgctggaatttctacagatcttcgcagtttaattgccttgatgcttgactctgatccg
aggattcgtccaacaagtcgagatttgcttgatcatccggtaatcaagaagaagctcatg
aagcgtggaacctatgtaaaatgcatttcaattcttaacggctttttctacgccttcagt
gctgttcttgtctgggtaatggctttcttctcggtgctctttcatcctattgttcgcttc
catgctgcaattaaagaccggcaatcggaaatttgtgcgcaatttgtcaataatcagcag
cacactcccatccaaactccagagacttctaaagtttatttggaatctcttactggagtg
gctgttcgccaagcatctcaaattgtgtctcctttcgatttttccgatgatgagaatcca
ccaaacgcgcaacgccgtttgttcactggtgcagtgccgtgtcgcttgaactttgataac
gatcaagatgacgatgaggaacaggcgacttgctcatcatcaaactcttcagctattgag
ccccaattggatgaaccggagagtccgccgagaatgaacgatgttattgataaacttgga
aaacgaggaactccaagatcagctcgtcgtaatctcactttcaaccgtcatcgtcaagta
gccgcgtcagttgcaccgaaatcgtcgctaaatcattataatcatcacactggatctgga
gatggatttagtaataactctctaattccaattagtgatcaagaacgaacggaaaaatat
ctccgaatgcgactcaccgagcaacagttagattgggcagatcagaataatgtgatcgac
gaggctccaccaccaatgtcttgtccgccaagaatccgaagaagcattcgtgatctaccg
agaatgcctgttctcaactttaacgttctcgacgagccatcgaataaaccgactgttgat
catcatacgattttggagcaatcggaatcgccacgtagaagattaaatagaggggctaag
cctgtgcctcgtaatagaatgatgtcatttggatcatcaggcgacgaggtttaa

DBGET integrated database retrieval system