KEGG   Caenorhabditis elegans (nematode): CELE_Y54E10BL.4
Entry
CELE_Y54E10BL.4   CDS       T00019                                 

Gene name
dnj-28
Definition
(RefSeq) DNaJ domain (prokaryotic heat shock protein)
  KO
K09523  DnaJ homolog subfamily C member 3
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_Y54E10BL.4 (dnj-28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_Y54E10BL.4 (dnj-28)
Chaperones and folding catalysts [BR:cel03110]
 Heat shock proteins
  HSP40 / DNAJ
   CELE_Y54E10BL.4 (dnj-28)
SSDB
Motif
Pfam: TPR_2 DnaJ TPR_1 TPR_9 TPR_17 TPR_19 TPR_11 TPR_14 TPR_8 TPR_16 ANAPC3 NARP1 TPR_12 TPR_15
Other DBs
NCBI-GeneID: 171870
NCBI-ProteinID: NP_491084
WormBase: WBGene00001046
Ensembl: WBGene00001046
UniProt: Q9N3E0
Position
I:join(2996510..2996620,2996666..2996908,2997556..2997890,2999165..2999508,3000815..3001266)
AA seq 494 aa
MKTSLVILLSCFEFIYSLDDKTEAQREYEAGNALFVNRQYSDALTHYHKAIELNPTMYQA
IFRRATTYLAFGRSKPGLADLDTVLSQKPDFAGARQQRASVLLKMGQLERAAADFRYLID
HSASQETSQEAQEKLELISEHINQVEMLKSWITNGDCNNVIESTTHLLETQPWDASLYIY
RAKCYVAEDKVKSAIHDMKHAAKLSSDNTELLFEMSELEYKVADVRDSLGSIRECLKLNP
DHKKCYTSYKSLKKIVKSLDSMKASIEQQEWTKCLETGEKLLEKNEEIPIRMNIFRLMCQ
CNREDGNLGEAIQQCTRVLEFDDSDVETLIQRAEAYMADEEYDMAIADYEKAEEWDSSND
AVRTGKDQAKRAKELVGKRDYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEKKK
AEKKFIDIAAAKEVLSNEEKRRAFDNGQDPLDSEAGRGGGGGGGSHGFHNFHGFNPFGGG
GGGGRGGGDFFFHF
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaaaacaagtctagtaattctgctctcttgtttcgagtttatctactcactagacgac
aaaaccgaggcacaaagagaatatgaagccggaaatgcgttatttgtcaatagacaatat
tccgatgctctcacacattatcacaaggctatcgagctaaacccgacaatgtatcaggca
attttccgccgagccaccacatatctagccttcgggcgttcaaagccaggcctcgccgat
ctcgacacagtcttaagccaaaaaccagatttcgctggagcaagacaacaaagagcaagt
gttctgttgaaaatgggacagctggagcgtgccgccgccgattttcgatatttgatcgac
cattctgcttcacaagaaacttcacaagaagctcaagagaaactagagctcatttcagag
catataaatcaagttgaaatgttaaaaagctggattacaaatggagattgcaataacgtc
attgaatcgacgacgcatcttcttgaaactcaaccctgggatgcttctctgtacatttat
cgtgcaaaatgctacgtggcggaggataaagtgaaatcagcaattcatgatatgaaacac
gcagcgaaactttcttctgataacaccgagttgctctttgaaatgtccgagttggagtat
aaagtcgcagatgtcagagattcgttaggttcaatccgcgaatgtctgaagcttaatccg
gatcacaaaaaatgctacacctcctacaaatcactgaagaaaatcgtaaaatccctagat
tctatgaaggcatcaatcgaacaacaggaatggacaaaatgcctggaaactggtgaaaaa
cttctggaaaagaacgaagaaattccgattcggatgaacattttccgattgatgtgtcaa
tgtaatcgagaagacggaaatctaggagaagccattcaacagtgtactcgagtactggaa
tttgatgattctgatgtggaaacgttgattcagagagctgaagcttatatggcagacgag
gagtatgatatggcaatcgctgactacgaaaaagccgaagaatgggattcatcaaacgac
gccgtccgaactggaaaagatcaagcaaagcgtgcaaaggaactcgtcggaaaacgagat
tactacaaaattctcggagtccgccggaacgccaataaacgagaaatcacaaaagcctat
cgaaaaatggctcaaaaatggcatccggacaactttcaggatgagaaggagaagaagaaa
gctgagaagaagtttatcgatattgccgcggcgaaggaagttttgagcaatgaggagaag
cggcgagctttcgataatggacaagatccactggattcggaagcagggaggggtggaggt
ggaggtggaggatcacacggatttcataatttccacggatttaatccattcggcggtggt
ggtggtggcggccgtggtggcggcgactttttcttccatttttaa

DBGET integrated database retrieval system