KEGG   Caenorhabditis elegans (nematode): CELE_Y54G2A.17
Entry
CELE_Y54G2A.17    CDS       T00019                                 

Gene name
nprt-1
Definition
(RefSeq) Nicotinate phosphoribosyltransferase
  KO
K00763  nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00760  Nicotinate and nicotinamide metabolism
cel01100  Metabolic pathways
cel01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CELE_Y54G2A.17 (nprt-1)
Enzymes [BR:cel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     CELE_Y54G2A.17 (nprt-1)
SSDB
Motif
Pfam: NAPRTase_C NAPRTase_N NAPRTase QRPTase_N
Other DBs
NCBI-GeneID: 177070
NCBI-ProteinID: NP_500265
WormBase: WBGene00021882
UniProt: Q95XX1
Position
IV:complement(join(2872224..2872301,2873229..2873411,2875195..2875383,2879262..2879611,2880709..2880880,2881647..2882341,2885235..2885256))
AA seq 562 aa
MSFILPSESIDGTHPCNGLHMNGQDSLVQPLLTDFYQITMCYAYWKTGTHNEPAVFDVFF
RKNPFQGEFTVFAGLEDCLRFVENFKFSQSDIDYVKKILPENAEPEFYEYLETLNGSHLT
IEAVAEGSVVFPKVPLLTINGPLAMCQLIETSILNLVNYASLVATNAARFRQASGWKIQL
LEFGLRRAQGPNGGLTASKYCYIGGFDATSNVLAGKLYGIPVKGTQAHSFICSFSSPAEL
KVRLLNHKITNEKADLFQISMEKRAWLLDQFSWKAALSEVSDGELSAFVAYAIAFPDTFL
ALIDTYDVIRSGVVNFVAVSLALHDLGYRSMGCRIDSGDLSYLSKELRECFVKVSTLKGE
YKFFEKMSIVASNDINEETIMSLNDQQHEINAFGVGTHLVTCQKQPALGCVYKLVAQSAQ
PKIKLSQDVTKITIPGKKKCYRIFGKNGYAILDLMMLEDEPEPQPNQQILCRHPFEESKR
ALVNANKIIKLHNVYWKDGEMITPLPTLNEIKEHVNESIRSTLRQDHRRYLNPTPYKVSV
SERLYQFLHTLWLQNAPIGQLE
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgtcgttcattttgccatcagaatcaatcgacggaacccatccgtgcaacggtctccac
atgaacggacaagactcgctggtgcagccgctgctcaccgacttctaccaaatcacaatg
tgctacgcgtactggaagactggtactcataacgagccagcagtgtttgacgtgttcttc
cgcaagaatccattccagggagagttcaccgtgttcgccggccttgaggattgtctccgc
ttcgtcgaaaacttcaagttcagtcaaagtgatattgactacgtgaagaagatacttccg
gagaacgcggaacccgagttttacgagtatctagagactctgaatggaagtcacttgact
attgaggcagtcgccgaaggatccgttgtcttcccgaaggttccacttctcacgatcaat
ggcccattggctatgtgccagctcatcgagacatcaattctgaaccttgtcaactacgcg
agcctcgtcgccacaaatgcggcaagattccgtcaagcatcaggctggaagattcaactg
ctcgaattcgggctccgcagagcacagggaccgaacggagggttgactgctagcaagtat
tgttatattggaggtttcgatgccaccagcaatgtgctcgccgggaagttgtacggaatt
ccggtaaagggaacccaggcgcacagcttcatctgctcattctcgtcgccggctgagctc
aaagtccgcttgctcaaccacaaaatcacaaatgaaaaggcggatttattccaaatttcc
atggaaaaacgagcgtggcttctcgatcaattctcgtggaaagccgcactttcagaagtt
tccgatggagaattgtcggcttttgtcgcctatgccatcgcttttccagatacattcctc
gctctaatagacacttatgacgtcatccgaagtggagttgtcaatttcgtggccgtttcg
ctggctcttcacgatttgggctatcgatcaatgggatgccgtatcgattcgggagatttg
tcgtatttatcgaaagagctgcgagaatgttttgtgaaagtttcgacactgaaaggcgag
tacaaattctttgagaaaatgtcaattgtcgcgtcgaatgacattaatgaggagactatc
atgtcattgaatgatcaacaacacgagattaatgcatttggagttggaacacatttggtt
acttgtcagaagcaaccagcgttgggatgtgtttataagctggttgcacaatccgcacag
ccaaagataaagctgagtcaggatgtcacgaaaatcacgattcccggcaaaaagaagtgt
tatcgtatatttggaaagaatggatacgcaatcttggatcttatgatgctggaagatgaa
cccgaaccacaacccaatcaacagattctttgcaggcatccgtttgaggaatccaaacga
gctctggtgaacgcgaataaaatcattaagcttcataatgtgtactggaaagacggagaa
atgattacaccacttccaacactgaatgagatcaaagaacacgtgaatgagtcgattcgt
tcaacacttcgacaggatcatcgacgatatttgaatccgacaccttataaggtatccgta
tcagagcgtctctaccaattcctgcatactctgtggctccaaaatgctccaattggccaa
ctcgaatag

DBGET integrated database retrieval system