KEGG   Caenorhabditis elegans (nematode): CELE_Y54G2A.18Help
Entry
CELE_Y54G2A.18    CDS       T00019                                 

Gene name
Y54G2A.18
Definition
(RefSeq) Uncharacterized protein
  KO
K14009  B-cell receptor-associated protein 31
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_Y54G2A.18 (Y54G2A.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bap31 Bap31_Bap29_C ATP-synt_D CENP-F_leu_zip DUF1385 TBK1_CCD1 DUF3450 Ntox28 FlxA Spc7 BST2
Motif
Other DBs
NCBI-GeneID: 177072
NCBI-ProteinID: NP_500267
WormBase: WBGene00021883
Ensembl: WBGene00021883
UniProt: G5EBI0
Position
IV:complement(join(2891685..2891873,2891928..2892288,2892397..2892488))
Genome map
AA seq 213 aa AA seqDB search
MTLQWTIVAGVLYAEIAITFTLLLPWIRPTLWSKLFKSRLFTALAKHAHIYSITFGFVLF
ILFADGVRETMKYNGLEGQMGRTAESDATHHMRLFRAQRNLYISGFALLLWLVIQRIMTL
LGRAAQLEAASEAAMRQAESATKTARTLMNSADTNEEAAGLAKQIEKLKGELKSANTDRD
TLKKQSEGLQREFDRVSDLLRDSAESKGDKKKD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacacttcagtggaccatcgtggccggcgtgctttacgcagaaatcgccatcaccttc
accctccttcttccatggatcagaccgactttgtggagcaagttgttcaagtcccgtctc
ttcacagctctcgccaaacatgctcacatctattcgatcacgttcggcttcgtgctcttc
atcctcttcgccgacggcgttcgcgagacaatgaagtacaacgggctcgagggacaaatg
ggccgtaccgccgaatccgacgccacccaccacatgcgtctgttccgtgcgcagagaaat
ctctacatttccggcttcgctcttctcctttggctcgtcattcagcgtattatgaccttg
ttgggccgcgccgcccaacttgaagccgccagcgaggccgcaatgcgtcaagccgaatct
gctaccaagaccgccaggactttgatgaactcggctgacaccaacgaagaagccgccgga
ttggcaaagcaaatcgagaagctcaagggagagctcaagtccgccaacactgaccgtgac
actctcaagaagcaatccgaagggctccagcgcgagttcgaccgcgtctccgatcttctc
agagattctgccgaatccaagggtgacaagaagaaggactaa

DBGET integrated database retrieval system