KEGG   Caenorhabditis elegans (nematode): CELE_Y55D5A.3
Entry
CELE_Y55D5A.3     CDS       T00019                                 

Gene name
Y55D5A.3
Definition
(RefSeq) N-acylethanolamine-hydrolyzing acid amidase subunit beta
  KO
K13720  N-acylethanolamine-hydrolysing acid amidase [EC:3.5.1.-]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_Y55D5A.3 (Y55D5A.3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     CELE_Y55D5A.3 (Y55D5A.3)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C89
   CELE_Y55D5A.3 (Y55D5A.3)
SSDB
Motif
Pfam: NAAA-beta CBAH AAT
Other DBs
NCBI-GeneID: 190304
NCBI-ProteinID: NP_497647
WormBase: WBGene00021917
Ensembl: WBGene00021917
UniProt: Q9GUI1
Structure
PDB: 
6DY3

Position
III:complement(join(2970677..2970965,2971697..2971898,2971958..2972187,2972812..2972896,2972944..2973038,2975619..2975785))
AA seq 355 aa
MLLLQIILLLLPVICSAGDRKPRHYEINLDEPPSQRWNQVIKDHLEYLPGVVEETKKYIP
KPLQPFVWWAASKIDRYFTTEIQEELKGIASESGLPIGEIVGMNILYDVAAFDRRHIFGL
GCTSIVAQNSAGQIIHGRNLDYDMTELLKNITIHVDFVRNGTIQYSGLTFALYNGVLTGQ
RPGEYSVSLNARYSGAYIDNILMEFYTKFKRPVSFFIRDVLENQATYTEAVDAFSRTHLF
SPSYIIVAGIKKNEGVVISRNRWSAANVYPLNVDANQWFLVETNFDNWKKQGDDRRITAI
QKLKELGRRNFDEKSMVEVLSTVPVRNNLTVFSTVMVPGLPDSADYFRQSTWILP
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgctcctgctccaaataatcttgctcctgttacccgtaatctgctccgccggagaccga
aaaccacgacattatgagataaatctggatgagccaccgagccaacggtggaatcaggtc
attaaggaccatttggagtatttgccaggcgttgtagaagagacaaaaaaatacattccg
aaaccgcttcagccattcgtttggtgggccgcttcaaaaatcgatcgatattttacgacg
gaaattcaggaggaactgaaaggaattgctagtgaatcaggtctaccaattggggaaatt
gtcgggatgaatattctttacgatgtggcggccttcgatagaagacacatttttggcctc
ggatgcacctcaattgttgctcaaaactctgcgggtcaaattattcacggtcgaaacttg
gactacgatatgaccgagcttctgaagaatatcacaatccacgtggattttgttagaaac
gggaccatacagtactccggactcacatttgccctgtataatggagtacttacaggacag
cggcctggtgaatacagtgtcagcttgaatgcaaggtactctggcgcctacatcgataac
attttaatggagttctacacgaaattcaagcgaccggtgagcttcttcattcgggatgtt
ctggagaatcaggcgacctatacagaagctgtggatgctttttcgagaacacatctgttt
tctccttcttatataattgtggctggaatcaagaaaaatgaaggagttgttatttccaga
aaccgttggtcagctgcaaatgtgtaccctctaaacgtagacgccaatcaatggttcctc
gtggaaaccaactttgataactggaaaaagcaaggcgatgaccgaagaatcactgcaatt
cagaagcttaaagagctcggaagacggaatttcgatgaaaagtcaatggttgaagtgttg
tcgactgtgcctgtcaggaataatttgaccgtttttagtactgtaatggtgccgggcttg
ccggattccgcggattatttcagacagagcacgtggattttgccctga

DBGET integrated database retrieval system