KEGG   Caenorhabditis elegans (nematode): CELE_Y55F3AL.1
Entry
CELE_Y55F3AL.1    CDS       T00019                                 

Symbol
plx-1
Name
(RefSeq) Sema domain-containing protein
  KO
K06820  plexin A
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Plexin_cytopl Plexin_RBD TIG TIG_2 TIG_plexin PSI Sema
Other DBs
NCBI-GeneID: 246019
NCBI-ProteinID: NP_001294554
WormBase: WBGene00004047
Ensembl: WBGene00004047
UniProt: U4PRY7
Position
IV:join(959521..959658,960846..960975,963030..963145,964140..964441,965737..965982,967066..967331,967901..968037,968662..968978,969803..970056,971064..971245,971307..971414,971876..971982,972373..972922,973764..973914,974470..974641,975269..975394,975450..975599,976199..976658,977242..977751,978858..979211,980654..980812,981560..981993,982729..983116,983596..983709)
AA seq 1956 aa
MPTFLQFFIIFGVAAAAAGSKNVYSIDDNLVFKNPSHDGHEVFEKMAIDPSTTRVFVGAV
NSLYDLTSADLTVRRHVQTGPQDDSPLCRDARNREECRHQLSRTNSHTKALSVYDKSSKL
IECSNLYQGRCRLRNLHNISEVISEAIEPRVSNDTSSSVVIFVGSGPANLSSEPVLYVGA
TIGSGDHDRMSVSSLFLRPQKAFEVVFPGLYGGTHVSLDYRSRGYYKYQIDYINGFESGD
YAYFVTRQRVNIADDSSIQSRLVRVCTGDKNFHSYTEVPLECTQNGVEFNLVQDVYVTRA
GYELAKSLDISVSDPVLYGVFWEGDKNSYRSQEPTGKSAICMFTMREIETSFKQNIMKCY
KGTSGLKKNLPWFSSNDDCRFTTLPWEGIKCGKDVNSKIGGDTPISTSATYVMEDSSNLL
TAIAINTTRSSTVAFVGTQGGQLHKILIESKRSAEKYATEMLTDNEPILSDMEFGGDGKH
VYILTPSKVIKMPTSRCEALSTQCDTCLSSRDPYCGWCVSNNHCTQEESCEREVPHTSRG
WLDFQNSKCPRIRSVKPDQIQINTADYLNVTIENLQAPKGRRMQCLFQFSTGDAVVSDPM
PFDGSLKCATPPMNRLPRIPTNEYHLPAKLIVVSDGSKLPLATTNFSFYDCNRYTSCSTC
SASQFPCDWCLESNECVAGKLTEDKCRKQHIVNGLNRDGSSIRKGPSKCPHIVAPVSKMS
VATGERRNISVKVENVDATFMGDFKCEFKYGTVTHEKIAMRTSDDTITCDEMLFEPYGTS
LLGSGSTPYGFNVIWSATGFAVGKKSINRVLDNVASLAIDVYSCENLATNCGRCLTLDAD
KYDCGWCSLDSKCARPHQCSNRQIPENWLNASQLCPNPVIEDFKPKKGSIFGGTRVTING
INLGRHVSDVEKAVQIANVPCEVVEYVPSQKIVCVTGKSPIKGSNERGVVAVTLRHDSLK
FFAHSTEHFSYVQPVVSSMKPVKGPRSGGTDVTLTGVDLDTGAEVTVRFGQIGCKILERA
SGWLRCRMGASGEGGQFPLHIAFDGQLQNLPIPIYFEFTSDPSVQSISPNKTIPSGGITV
DVYGQGFTLLQRPRMVFTGLGDEKSYGPACSIEDDQMMKCATPTAPGKDSDRGSQERITE
YAFDFDGAELYRSRIKVMPSPTFETLSEPRFVRPGEDFLTLNGNHLNLAASERDIDVKVG
GEPCPLTALANKVLTCQPPVKKPRGAGKLNPEIVVTVGNASFSIGEVSYDSPGLSSSLFF
IIMFFIIFMIALIICLIVLYRRKSNTHQRQMKYLKTQMDTIEMKVATECKEAFAELQTSL
NQYTADLPLGTPTAPFLEYKDYCARVLFPNAGKNHAVLKNLEVDTHKAEAIEAGLREFHK
LLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTV
EKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDA
LTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIPVRVLDCDTITQVKEKCLD
AKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWKRLNTLAHYNVPNNA
ILTLTSKSNSLYNLVNFSSTSMKTASILSDRSEKSSVSMKTPGVGSPKPWGAPPSVIADH
ASSSADTDNGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFS
SSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPT
KIEGCLSVVAQTLMDACSTQDHQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMTPRID
DATMGANLSAESRQHNGEFHVFSALNELYKYLDQYKESIIDALESNEHAQASRLPGRLQD
LLALMESDYYRATDYESSTLGLGYNSNSRLMPRDRL
NT seq 5871 nt   +upstreamnt  +downstreamnt
atgcccacatttctccaatttttcatcattttcggcgtcgccgccgccgccgccggctcg
aaaaatgtctattcgatcgatgataatctagttttcaagaatccaagccatgatggacat
gaggtttttgaaaaaatggcaatcgatccatcgaccacacgggtatttgttggtgctgtc
aatagtctttatgacctgacaagtgccgatttaactgtaagaagacatgtacaaactgga
cctcaagatgattcgccattgtgtcgtgacgctcgaaaccgtgaggaatgccgtcatcag
ttgtctcgaacgaattcacacacaaaagcattatcagtttatgataaatcatcgaaactt
attgaatgcagcaatttgtatcagggtcgctgccgtctccgtaacttacacaacatctca
gaagtgatatcagaagccattgagccacgtgtctcaaatgacacgtcatcatccgtcgtg
atattcgtgggctccggcccggcgaatctaagctctgagccagttttatacgttggagca
actatcggaagtggagatcatgatcgaatgtctgtctcttcgctgtttttgagaccgcaa
aaagcttttgaagttgtgtttccgggactttatggtggaactcatgtctcgttggattat
cggagtagaggatattataagtatcaaatcgactacatcaacggtttcgaatcgggagac
tatgcgtattttgtaactcggcaacgtgtcaacattgctgatgattcatcgattcaatcg
agacttgtccgtgtctgtactggggataagaactttcatagttatactgaagtaccgttg
gaatgcactcagaatggtgtggaattcaatttggttcaagatgtatatgtcacacgtgcc
ggatatgaattggcaaagtcgctggatattagtgtaagcgatccggtgctctacggcgtc
ttctgggaaggcgacaaaaattcgtaccgatcacaagagccgactggaaaatcagcgatt
tgtatgttcacgatgcgtgaaattgagacatcattcaagcagaatatcatgaaatgttat
aaaggaacgtctggactcaagaagaatcttccgtggttctcgtcgaatgacgattgtcga
tttactacacttccatgggagggaatcaagtgcggaaaagatgtgaactcgaaaattggc
ggtgacactccaatttccacgtcagccacgtatgttatggaggattcgtccaacttgctc
accgccatcgctataaacacgacgcgctcgagtacggtagcatttgtggggacacaagga
ggacaactgcacaagatccttatcgaatcaaaaaggtccgccgaaaaatacgccactgaa
atgctcaccgacaatgagcccatcctctcagacatggaattcggcggcgacgggaagcac
gtctacattctaaccccgtcaaaagtcatcaaaatgccaacatcccgatgtgaagcactg
tccacacaatgtgacacgtgtctttcgtcgcgagacccatattgtggatggtgtgtcagc
aataatcactgtacacaggaggagtcgtgtgaacgagaagttccgcacacctcgagagga
tggcttgattttcagaattcaaagtgtccaagaattcgaagtgtaaaaccggatcaaatt
caaatcaacacagccgactacctgaatgtgactatcgagaatcttcaggcaccaaaaggt
cgccgtatgcagtgcctattccaattttcgaccggagacgccgtcgtctccgatcccatg
ccgtttgatggctcactgaagtgtgcaacgccgccgatgaatcggttgccacgaattccg
actaatgaataccatttaccggctaaattgattgtggtgtctgatggcagcaagcttccc
ctagcaactacaaatttctccttctacgactgtaaccgctacacttcatgctcaacgtgc
tcggcgagccaatttccgtgtgactggtgtctcgagtcgaatgagtgtgtagccggaaaa
ctgactgaggataaatgccgcaaacagcatattgtcaacgggctaaatcgcgacgggagc
tcgattcggaaaggtcccagcaagtgtccccatattgtggcgcctgtttcgaaaatgtct
gtggcgactggagagagaagaaatattagtgtaaaggtagaaaacgtggatgccacattt
atgggcgatttcaagtgcgaattcaaatatggtacagtaacccatgagaaaatcgcgatg
cgaacgtccgatgacactattacatgcgacgaaatgctctttgagccctacggcacctct
ctcctgggctccggctccacaccatacggcttcaacgtcatctggagtgccacaggcttt
gccgtcggaaaaaaatcaataaatcgagtgctcgacaacgtggcctcactggcgattgac
gtgtactcttgtgagaatctggcgacaaattgcggtcgttgcctaacccttgacgcggac
aaatacgattgtggctggtgctcgctggatagcaaatgcgctcgaccgcaccaatgctca
aatcgacagattccggagaattggctcaacgcgagccaactatgcccgaacccggttatt
gaggatttcaagccgaaaaagggatcgattttcggcggaacccgggtcacaattaacgga
atcaacctgggacgccacgtgtcagatgtcgaaaaagccgtacaaattgcaaatgtcccg
tgtgaagttgtcgaatatgttccgtcgcagaaaattgtgtgtgttactggtaaatcgccg
attaagggaagcaatgagcgaggtgttgttgcggtaaccctccgtcacgactctctgaag
ttttttgcccactcaaccgaacatttctcttatgtacagccagttgtgtcctcaatgaag
ccagtgaagggaccacgatccggcgggacagatgtcacattgactggtgttgatttggat
acaggagccgaagttactgtcagattcggacaaattggatgtaaaattctcgagcgagct
tctggatggctcagatgtcgaatgggagcatctggagaaggagggcagttcccactgcac
atcgcattcgacgggcagctccaaaacctaccgattccgatttatttcgaatttacctcc
gatccatcagttcaatcgatttcaccaaacaagacaataccatcaggcgggattactgta
gatgtgtacggtcaaggcttcacacttttacagaggccacgtatggtttttactggattg
ggcgacgaaaagtcttatgggcccgcatgctccattgaggatgatcaaatgatgaagtgt
gcaacgccgacggctcccgggaaggattcggacaggggctcacaggagagaattacagaa
tatgcttttgattttgatggcgctgagctatatcgctcccgaatcaaagtgatgccttcc
ccaaccttcgaaaccctctcagaaccccgattcgtgcgccccggcgaggattttctgacc
cttaacggaaatcacctgaacctggccgcttcggagagggatattgatgtgaaagtcggc
ggtgaaccatgcccactgactgctctcgccaataaagtgctcacttgccagccgccagtg
aaaaagccacgcggagccggaaaattgaatccagaaattgtggttactgtcggaaatgcg
tcgttttccattggagaagtatcgtatgactcgccgggactctcatcgtcgctttttttc
attatcatgttttttatcatttttatgattgctcttatcatttgcctgattgtgctgtac
cgccggaagtcgaatactcatcagagacagatgaaatatttgaagactcaaatggatacg
attgagatgaaggtagccacagaatgcaaggaagccttcgccgagcttcaaacctctctg
aatcaatacaccgcagatcttccactcgggaccccaacagcgcccttcctcgagtacaag
gactactgcgcccgtgtgctcttcccgaacgccggcaaaaaccacgcagtgctcaaaaat
ctagaagtggacacccataaggcagaagccatcgaagcagggctccgcgagttccataag
ctgctcatgaacaagacattcctgctcacaatggtccggacgatggaggccaacaaatat
tttgttgggaaggatcgtgtctatgttggaagtcttctaatggttgtactacaagagaaa
atgggttactgtactgagatgttgaagcagttgctccgagagttgattgagaaaactgtg
gagaagaagtttcagccgaaaatattgttccgtcggagtgaaagtattgctgagcggatg
ctcgccgcgtggttcacatttttgctacatgatcatttaaagacatacgatgccggaaag
aagctctacgagctcttctggggaatcaagcaacaaatggaaaaaggtccacaagacgct
ctaacccttgaagcccgttattccctttccgaggagaaactgctccgagccactttcgaa
tacaaagagctgatggttttcgtgtcggccagtgattcggtgtacagttcaacacaagac
atacctgtaagggtactagactgtgacacaattactcaggtcaaggagaagtgtctcgac
gcgaaatatcgcggatatcgattcgcggatcgaccggctcccggtgatatggagttggag
tggaagactggaatgaatgggaaaatggcgttacaggatattgattcatcatcccgtgtc
gagggtggaaattggaagcgtctgaatactctggctcactacaatgtaccgaacaatgcg
atactcacgttgacgtccaaaagcaattcgttgtataatctggtgaatttttcgtcgacc
tccatgaagacagcgagcatactatcggatagatcagaaaaatcgtcagtttcaatgaaa
acgcccggagtcggctcaccgaagccctggggagccccgccatcagtgatagccgatcac
gcgagttcatcagctgatactgataacggattcaagctttatcatctggtaaagcctacg
gagcacggaccaacggattcccaagagaaaatggtgacggagatctacctgacgcgccta
ctcatgatgaagggaaccctggcgaaattcatcacttctctgttggagagcatcttttcg
tcgtctacagtacccccttgcattaagtatatgtttgattttatggatgaacaagctcga
gagcatggaatcaacgatccggaggtggtgcacgcgtggaagagcaacgcattgcctctg
aggttttgggtcaatttgatcaagaacccccatttcctattcgacatccaaaagcccacc
aaaatcgaaggatgcttgtcagtagttgctcaaactctaatggatgcctgttccactcaa
gaccatcagctcacgaaagactcgccgagctcaaagctccttttcgcaaaggatatgtac
caatacagggaccttgtcgactcgtattacactgaaatttccatgacgccgcgtattgat
gatgcgacgatgggcgccaatttgtctgcagaatcccgacaacacaacggagaattccac
gttttttcggcgctcaacgagctctacaagtacctggatcagtataaggagagcattatc
gatgcgttggagagcaatgagcacgctcaggcaagcaggctgcctgggaggttacaggat
ctgctggcacttatggaatcagattactaccgggcaaccgattatgaatcatcaacactc
ggactcggatacaattcaaatagccgcctaatgccacgtgatcgactgtga

DBGET integrated database retrieval system