KEGG   Caenorhabditis elegans (nematode): CELE_Y55F3AR.3Help
Entry
CELE_Y55F3AR.3    CDS       T00019                                 

Gene name
cct-8
Definition
(RefSeq) T-complex protein 1 subunit theta
  KO
K09500  T-complex protein 1 subunit theta
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_Y55F3AR.3 (cct-8)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_Y55F3AR.3 (cct-8)
Chaperones and folding catalysts [BR:cel03110]
 Heat shock proteins
  HSP60 / Chaperonin
   CELE_Y55F3AR.3 (cct-8)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    CELE_Y55F3AR.3 (cct-8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 176928
NCBI-ProteinID: NP_500035
WormBase: WBGene00021934
Ensembl: WBGene00021934
UniProt: Q9N358
Position
IV:complement(join(1087812..1088002,1088934..1089287,1089881..1090115,1091668..1092174,1093440..1093514,1093567..1093703,1093766..1093913))
Genome map
AA seq 548 aa AA seqDB search
MAMKIPKSGYNRFMKEGAQHFKGTDEAVQRNIEACTELASQIRSAYGPNGMNKMVINHIE
KLFVTNDAATILKELEIQHPAARIIIMATEMQEKQIGDNTNTVVILAAALLEHAANLIHM
GMTPQEVAAGYEQAAEKALEILPTLVVKEATDMKNIEEVRQYIRSAITSKQYDNEDIIAD
LVAKACVTTCPANSFNFNVDNIRICKIIGSGVHTSTVMNGMVFKRGAEGEIREARDARIA
VYTCPFDLTQTETKGTVLIENADELRNFSKGEEAEVEEQVKAIADNGVKVVVAAGKFGDM
YLHFLNKYKIMAVRLTSKFDLRRLCRTVGAQPQARICAPAVNLLGHCDSVAVQEIGDENV
VVFDKKSETGKVATIIIRGSSQSRIDDVERAVDDAVNTYKALTKDGKLLAGAGAVEIELA
KEIESFGAKAPGLEQYAIKKFAHALETLPKAIAENAGMPTTETLTKLYAEHVAGKKNAGI
DIWKRETMDAVVNNIFDLYAGKRLAIKLATDAASTILKVDQIIMSKQATGGPKPRGPKAQ
DEDDDGMA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctatgaagatcccaaagtccggttacaaccggttcatgaaggaaggagctcagcac
ttcaaaggaaccgacgaggctgttcagaggaatatcgaggcctgtacggagctcgcttcg
cagattcgatcggcctacggaccaaatggaatgaacaaaatggtgattaaccacatcgag
aagctcttcgtcaccaacgacgccgccaccatcctcaaggagctcgaaattcagcatccg
gccgcccgtatcatcattatggccaccgagatgcaggagaagcagatcggagacaacacg
aacaccgttgtgatcttggcggccgctttgttggagcacgctgcgaatctcatccatatg
ggaatgacaccacaagaagtcgctgccggatacgagcaagccgccgagaaagccctcgaa
atcctgccaacattggttgtaaaagaggctacagatatgaagaatatcgaagaagtccgt
caatatattcgttcagcaatcacctcaaaacagtacgataacgaggatattatcgctgat
ttggtggcaaaagcgtgtgtaaccacgtgcccggccaacagtttcaacttcaacgttgat
aatatcagaatctgcaagattattggctcaggagttcatacttcaacagttatgaacgga
atggtctttaaacgtggagccgagggagaaattcgtgaagctcgcgacgctagaattgca
gtttatacttgtccatttgacttgactcagactgaaactaagggaactgttcttattgag
aatgctgatgagcttaggaacttctccaagggagaggaagctgaagttgaagagcaagtt
aaagctattgctgataacggtgttaaggttgtcgtcgccgctggaaagttcggagacatg
tacctccatttcctgaataaatacaaaattatggccgtccgtcttacatcaaaattcgat
cttcgccgcctctgccgtaccgtcggagctcaaccacaagcaagaatctgtgctccagct
gttaatctgttgggacactgtgattctgtggctgttcaagagattggagacgaaaatgtc
gtcgttttcgataagaaatcggaaaccggaaaagtcgccacaatcataatccgtggatcc
tctcaatctcgtattgatgacgtcgaaagagctgtcgatgatgctgtaaacacctataaa
gctcttacaaaagacgggaaattgctcgccggagccggagccgtcgaaattgagctcgcc
aaagaaattgagtcgtttggagcaaaagcacctggtttggagcaatatgcaatcaaaaag
ttcgcccacgcactcgaaactcttccaaaagctattgctgagaacgctggaatgccaacc
actgaaactctgacaaaactctacgcggagcatgttgctggaaagaaaaacgctggaatt
gatatctggaagcgggaaacaatggacgccgtcgtcaacaacattttcgacctctacgct
ggaaaacgactggcaattaagctcgccacagacgccgccagcacaattctcaaagttgat
cagattattatgtcaaagcaggcgactggaggaccaaaaccacgtggaccaaaggctcaa
gatgaggatgacgatggaatggcctaa

DBGET integrated database retrieval system