KEGG   Caenorhabditis elegans (nematode): CELE_Y55F3BL.2
Entry
CELE_Y55F3BL.2    CDS       T00019                                 

Gene name
zipt-15
Definition
(RefSeq) Zrt (ZRT), Irt-(IRT-) like Protein Transporter
  KO
K14720  solute carrier family 39 (zinc transporter), member 14
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_Y55F3BL.2 (zipt-15)
Transporters [BR:cel02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   CELE_Y55F3BL.2 (zipt-15)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 190312
NCBI-ProteinID: NP_001294572
WormBase: WBGene00021936
Ensembl: WBGene00021936
UniProt: U4PS08
Position
IV:complement(join(808674..808823,809646..809749,809817..809903,811529..811736,817299..817379,821331..821462,822088..822231,823511..823582,823652..823749,824776..824941))
AA seq 413 aa
MTPMMDPSTSLSNYTFGNLDDLCRNYTTTTTTEIISTTVISHVALNSHERPPAVIVWGVG
LLFVTLINMCAVVGIGVMRYLTKNTYNQIITLFVGLGVGSLSGSSFYHLLPQAHPSLMDE
VDENGVPTHSYLHMAHISILGVYAFFFCDKLIKIILEIRKKNQHIHHRRLSIENPGMTTE
RSDSTFVTDAGDREEELLRSVLKKGVMSKADIDETEMMTLEDKSGKSMGDQAHGICVHDH
SIEFRAGDSAIAAVAWMIVFGDGLHNFIDGISIGAAFAESLHSGLSISLAVLCEEFPHEL
GDVAILVASGMTLKQALIYNLLSAITCYVGFFIGVGIGELGPDTSKYAFGLAGGMFLYIS
LACMMPEMKKAMEEALNVSLRHGIYVLFLQSVGLFSGLTLMYIMARYGESISI
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgacgccaatgatggatccatcgacgtcattatcgaattatacatttggaaatttggat
gatttatgtcgtaattatacaacaaccaccactacagaaatcatatcgactacagtaatc
agccacgtggcgctgaattctcatgagagaccgccagccgtaattgtctggggagtgggt
cttctgttcgtgacgctcatcaatatgtgtgcagtggtgggcattggtgttatgcgatat
ttgacaaaaaatacatataatcagataatcacactattcgtcggtctcggagttggatcg
ttgtcgggttccagtttttatcatttgttgccacaagctcacccatcactaatggacgaa
gtagatgagaatggtgtaccaactcattcatatcttcatatggctcatatttcaattctc
ggcgtctacgcgttcttcttttgtgataaacttatcaagattattctcgaaattcgaaaa
aaaaatcaacacattcaccatcgccgactatccatcgaaaatccgggaatgacgacagaa
agaagcgattccacatttgtcacagatgccggagaccgggaagaagaacttttgagaagt
gtcctgaaaaaaggtgtaatgagtaaagcggacattgatgagacggaaatgatgactttg
gaggataaatccggaaaatcgatgggtgatcaagctcacggaatctgtgttcacgatcat
tcaatcgaatttcgtgccggtgattcggcaattgctgcagttgcatggatgattgtattc
ggtgatggtttgcacaattttattgatggaatttcaattggagcagcttttgccgaaagt
cttcactcgggactatcgatttcgttggctgttctttgtgaggagtttccacatgaattg
ggtgacgtggcaatcctcgtggcttctggaatgacactgaaacaggctttaatttataat
cttctctctgcaattacatgttatgttggattcttcattggcgtcggaattggagaactc
ggccctgacacgtcgaaatatgcattcggattggctggtggcatgtttttatacatttcc
ctggcttgtatgatgccagaaatgaaaaaagcgatggaagaagccctaaacgtctcactt
cgtcacggaatctacgtacttttcctccaatccgttggccttttttcgggattaactctg
atgtacatcatggcaagatatggagaaagtatatcgatttga

DBGET integrated database retrieval system