KEGG   Caenorhabditis elegans (nematode): CELE_Y56A3A.19Help
Entry
CELE_Y56A3A.19    CDS       T00019                                 

Gene name
Y56A3A.19
Definition
(RefSeq) Acyl carrier protein
  KO
K03955  NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00190  Oxidative phosphorylation
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CELE_Y56A3A.19 (Y56A3A.19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding PP-binding_2 RNA_pol_RpbG Ribosomal_L50 Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 176622
NCBI-ProteinID: NP_499549
WormBase: WBGene00013237
Ensembl: WBGene00013237
UniProt: Q9U241
Position
III:complement(join(11915253..11915510,11915567..11915710))
Genome map
AA seq 133 aa AA seqDB search
MLRVAVSAALRTVSVRALSNASVQQRVITPILLSAQKPSFQIRQYSAKAPLTKKTLEERI
VLVLSLYDKIDAKKLTMDSDFSKDLGLDSLDHVEVVMAMEEEFGFEIPDGDADRFKTPRD
IFQYIADKEDVFE
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgagtcgccgtttccgctgctctccgcactgtttcagtgcgtgcactgagcaat
gcgtccgtccaacaacgagtcatcaccccaatactcctctccgcacagaaaccaagcttc
caaatcagacaatactctgcaaaggctccactgaccaaaaagacactcgaggagcgaatt
gtgttggttctctcactctacgacaaaatcgacgcgaagaagctcacaatggactcggat
ttctcgaaagatctcggcctcgactctctggatcacgtagaagttgtgatggcgatggag
gaagagtttggattcgagattcccgacggagatgcggatcgcttcaagacgccacgcgac
atcttccagtacatcgccgacaaggaagacgttttcgaataa

DBGET integrated database retrieval system