KEGG   Caenorhabditis elegans (nematode): CELE_Y56A3A.33Help
Entry
CELE_Y56A3A.33    CDS       T00019                                 

Gene name
Y56A3A.33
Definition
(RefSeq) Uncharacterized protein
  KO
K14570  RNA exonuclease 1 [EC:3.1.-.-]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CELE_Y56A3A.33 (Y56A3A.33)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cel03009]
    CELE_Y56A3A.33 (Y56A3A.33)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     CELE_Y56A3A.33 (Y56A3A.33)
Ribosome biogenesis [BR:cel03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    CELE_Y56A3A.33 (Y56A3A.33)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EloA-BP1 RNase_T DNA_pol_A_exo1 cEGF
Motif
Other DBs
NCBI-GeneID: 176636
NCBI-ProteinID: NP_499565
WormBase: WBGene00013244
Ensembl: WBGene00013244
UniProt: Q9U220
Position
III:complement(join(11999497..11999581,11999625..11999905,12000397..12000588,12000953..12001227,12002026..12002208,12002859..12002940))
Genome map
AA seq 365 aa AA seqDB search
MVIELHQLKKKRTGASLSSISSTSSEELSIPVEPLQKMAPAKLYNELLPLKLSFEQLKQN
GYPFWCSTSSQAVFAATANNKKDWAAPNDFYRKCSRCSKGFYLNPDGTANAQKCVYHHRA
KWDPLTGKKHLPCCSAKPGPSTKGCLVEDRHVFSQSWEDTLWEFVVSPQAKGKDDHRSNK
VFALDCELVHTLNGLEVARVSLVDMKGKVLLDTFALPVFEVISFNSTFSGVTEKDMESAI
SLEACRLQLFQLINSETLLVGHSLESDLKALRLVHHNVIDTAVLFSIVDPSRSYILKLSL
QNLAKKYLCKDVQSEASGHSSIEDSHTCMELLATRHLFFYCHGVQTNMKFGGKQLRKKPK
KNNKK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgaattgcatcaattgaagaaaaagcgcaccggagccagcttgagctcaatt
agctcgacaagttcggaggaattatcaattcctgtggaaccacttcaaaaaatggctcca
gccaagctctacaacgagctcctgccattgaagctgagcttcgagcagctaaagcaaaat
gggtacccattttggtgctcaacttccagtcaagctgtcttcgcggcaaccgccaacaac
aagaaggactgggctgctccaaacgatttctaccgcaaatgctcgagatgctcaaaaggc
ttctacctgaacccggacggaaccgcaaacgcccaaaaatgcgtttaccatcaccgagcc
aagtgggatccgttgaccgggaagaagcatttgccgtgttgctccgccaagccgggtcct
tccacaaaaggatgtctggttgaggatcgccacgtgttctcccagtcgtgggaggatacc
ctgtgggagtttgtggttagtccacaggcgaaaggaaaggatgatcatcggagcaataag
gtattcgccctggattgtgagctggtccatactctcaacgggctcgaggtggctagagtg
agcttggtcgacatgaagggcaaagtgctgctggacacttttgcccttcctgtatttgaa
gtaatcagcttcaacagcacgttttcgggcgtcaccgagaaggatatggagtcggcgatt
tcattggaagcgtgtcgcctgcagctcttccaactcatcaactctgaaaccctgctcgtc
ggtcactccctggaatcggatctgaaagctctccgccttgtccaccacaatgtcatcgac
actgcagtcctgttctcgatcgtcgatccatccagatcctacattctcaagttgtccctt
cagaatcttgcgaagaaatatctgtgtaaggatgttcagtcggaagcgtcgggtcattcg
tcgattgaggatagccatacttgtatggagcttcttgccactcggcatttgtttttttat
tgtcatggggtccaaacaaacatgaaattcgggggaaaacagctgagaaaaaaaccaaaa
aaaaacaacaaaaaataa

DBGET integrated database retrieval system