KEGG   Caenorhabditis elegans (nematode): CELE_Y57A10A.25Help
Entry
CELE_Y57A10A.25   CDS       T00019                                 

Gene name
parn-2
Definition
(RefSeq) PARN (Poly(A)-specific RiboNuclease) homolog
  KO
K13202  target of EGR1 protein 1
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cel03041]
    CELE_Y57A10A.25 (parn-2)
Spliceosome [BR:cel03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    CELE_Y57A10A.25 (parn-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CAF1
Motif
Other DBs
NCBI-GeneID: 174866
NCBI-ProteinID: NP_496602
WormBase: WBGene00013265
Ensembl: WBGene00013265
UniProt: Q9NA76
Position
II:complement(join(12251963..12252166,12253170..12253707,12254961..12255425,12256362..12256627))
Genome map
AA seq 490 aa AA seqDB search
MSGDGDSSTTSSAGDGSTSKDKIPAFSEIRVIEVNRDNFAKIWPYLLVCIKSADFTAIDL
ELSGLGGKGLRSRDIAERYQAIRDAAHTRSILSVGIATMKLTHKSEKRRALRYETQVFNI
LTFSEKPFTIEPSALQFLAKHSFDFNRLIQSGVRFQGANCPLKTLFRELLGSSATFCLHN
GFIDLAFIYKQLYDIDLPDTLDGFVNNLSDMFPDNYLPVADSKYLAEYQTRMTASFLEYV
FRRTQGDNEIERQNNRYHIEICFPSSEKSIKALKNATESVDVRLPEGFPDHAIPIDLHIH
VCKYFAYHGFCHARNTEKGCKLLHDVDTAIDLQRIKENKKAFKRKRRYNNVIAESVAEKT
GTDEEAWKNAKFEQNLLTRDFRELKRNVVTGLHRAGVDAFMTAFAVIYQQRRTLMADNSV
DLKFLNRVPLSAKDKPLHLRHRPVPVPQSEQIDAHLEAMVEINKQRDYIRMNAAATVIKS
VQKEDTPCED
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgacggggactcatcaacgacaagctccgccggcgacggcagcacttcaaag
gacaaaattccggcgttctcagaaattcgagttatcgaagtaaaccgcgacaatttcgcg
aaaatctggccatatttgcttgtttgcatcaaatccgcagattttacagcgatagatttg
gagttgagcggtctcggcgggaaaggactacgttcacgtgatatcgctgagagatatcag
gcgattcgtgatgccgcgcatactagaagcattctatccgttggaatcgccacaatgaag
ctgacgcataaaagtgaaaaacgtcgagctcttcgctacgagacccaagttttcaatatt
ctcacattctcagaaaaaccattcacaattgaaccatcggctcttcaatttctcgccaaa
cattctttcgatttcaacagacttattcaatcaggagtacgattccagggagccaactgt
ccattgaaaactcttttccgtgagcttctaggctcatcggccaccttctgccttcacaat
ggatttattgatttggcatttatctataagcagttatatgatatcgatttacctgacact
cttgatggattcgttaataatttgagtgatatgtttccggataactatctgccggtggcg
gattccaagtatttggcagagtatcagacgagaatgactgcctcttttttggaatatgtg
ttccggagaacgcaaggagacaacgagatcgagcgtcaaaataatcgatatcacatcgaa
atttgcttcccaagctctgaaaagtcgataaaagctctaaaaaacgctacggaaagtgta
gatgtacgtcttccagaaggattcccagatcacgcgattcccatcgatcttcacatccac
gtgtgcaaatatttcgcgtatcacggcttctgccacgctcggaacactgaaaaaggatgt
aaactgctccatgacgtggatactgctatcgatttacagaggattaaggagaataagaag
gcgttcaaacgaaaacggagatataataatgtgattgctgaatcggttgccgagaagacg
ggcaccgatgaggaggcatggaagaacgcgaaatttgagcagaatttgttgactcgagac
tttcgggagctcaagagaaatgtggttacagggctgcatcgggctggagttgatgctttt
atgacggcttttgcggtgatttatcagcagagaagaaccctgatggctgataattcagtt
gatttgaagttcctaaaccgcgttccactgtccgccaaagataagccattgcatcttcgc
caccgaccggtcccagttccacaatccgagcaaattgatgctcatttggaggcaatggtg
gagatcaacaagcaacgggactatattcgaatgaatgcagccgctacagttatcaaaagt
gttcagaaagaggatacaccttgtgaagattga

DBGET integrated database retrieval system